Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_937893.1 | Gene: | Lrrc4b / 272381 | MGIID: | 3027390 | Length: | 709 | Species: | Mus musculus |
Alignment Length: | 376 | Identity: | 107/376 - (28%) |
---|---|---|---|
Similarity: | 159/376 - (42%) | Gaps: | 91/376 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 189 TFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNA 253
Fly 254 LDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLG 318
Fly 319 SLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHL 383
Fly 384 HPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVL-------ESLSS 441
Fly 442 ------------------VQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPC----FVKLQ 484
Fly 485 HWLATRD-----------VVYLRD-----------NTGYYKGERPLCIVTN 513 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 24/66 (36%) |
LRR_8 | 104..164 | CDD:290566 | |||
leucine-rich repeat | 106..129 | CDD:275380 | |||
leucine-rich repeat | 130..153 | CDD:275380 | |||
leucine-rich repeat | 154..195 | CDD:275380 | 2/5 (40%) | ||
LRR_RI | 194..455 | CDD:238064 | 86/285 (30%) | ||
LRR_8 | 194..254 | CDD:290566 | 22/59 (37%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 220..243 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 244..267 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 271..330 | CDD:290566 | 16/58 (28%) | ||
leucine-rich repeat | 272..295 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 296..319 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 319..380 | CDD:290566 | 20/60 (33%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 344..369 | CDD:275380 | 9/24 (38%) | ||
LRR_8 | 368..428 | CDD:290566 | 23/59 (39%) | ||
leucine-rich repeat | 370..393 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 394..417 | CDD:275380 | 11/22 (50%) | ||
leucine-rich repeat | 418..441 | CDD:275380 | 10/29 (34%) | ||
Lrrc4b | NP_937893.1 | LRRNT | 59..92 | CDD:214470 | |
LRR | <89..299 | CDD:227223 | 71/222 (32%) | ||
LRR 1 | 89..110 | 2/2 (100%) | |||
leucine-rich repeat | 90..113 | CDD:275380 | 2/5 (40%) | ||
LRR 2 | 113..134 | 7/20 (35%) | |||
leucine-rich repeat | 114..137 | CDD:275380 | 9/22 (41%) | ||
LRR 3 | 137..158 | 7/20 (35%) | |||
leucine-rich repeat | 138..161 | CDD:275380 | 8/22 (36%) | ||
LRR 4 | 161..182 | 6/24 (25%) | |||
leucine-rich repeat | 162..185 | CDD:275380 | 8/26 (31%) | ||
LRR 5 | 185..207 | 10/44 (23%) | |||
leucine-rich repeat | 186..210 | CDD:275380 | 12/46 (26%) | ||
LRR 6 | 210..231 | 7/22 (32%) | |||
leucine-rich repeat | 211..232 | CDD:275380 | 8/22 (36%) | ||
LRR 7 | 232..253 | 7/20 (35%) | |||
leucine-rich repeat | 233..256 | CDD:275380 | 9/24 (38%) | ||
LRR 8 | 256..277 | 5/20 (25%) | |||
leucine-rich repeat | 257..280 | CDD:275380 | 6/22 (27%) | ||
LRR 9 | 280..301 | 10/20 (50%) | |||
leucine-rich repeat | 281..302 | CDD:275380 | 10/20 (50%) | ||
LRRCT | 313..363 | CDD:214507 | 9/52 (17%) | ||
I-set | 366..455 | CDD:400151 | 18/83 (22%) | ||
Ig strand A | 366..369 | CDD:409353 | 1/2 (50%) | ||
Ig strand A' | 373..376 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 382..389 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 395..400 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 403..405 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 414..418 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 421..425 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 435..442 | CDD:409353 | 3/11 (27%) | ||
Ig strand G | 445..455 | CDD:409353 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 496..552 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |