DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and SLITRK5

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001371538.1 Gene:SLITRK5 / 26050 HGNCID:20295 Length:958 Species:Homo sapiens


Alignment Length:613 Identity:142/613 - (23%)
Similarity:216/613 - (35%) Gaps:183/613 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CSEVASLQDLVDLGAENWHTLAIRNVQTELEVGSGENADHLANLLD------------------- 84
            |..|...||| .....:|....:....|.|.:...|..|:...:.|                   
Human     5 CPPVTLEQDL-HRKMHSWMLQTLAFAVTSLVLSCAETIDYYGEICDNACPCEEKDGILTVSCENR 68

  Fly    85 -----------------LDLTGAAPINVHTNGFSILPNLRQLNLSGCGLVDIRGNHFAPESALQR 132
                             |.|:|.....::.|.|........|:|....:.||....|.....|:|
Human    69 GIISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASILHLGSNVIQDIETGAFHGLRGLRR 133

  Fly   133 IDFSHNQMELLDRDFFGNLRKLIYANFSHNALKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQ 197
            :..::|::|||..|.|..|..|.|....:|.:...: |:                 .||....||
Human   134 LHLNNNKLELLRDDTFLGLENLEYLQVDYNYISVIE-PN-----------------AFGKLHLLQ 180

  Fly   198 ELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLS---SIGLETFQPLAQLRKLNLSQNA------ 253
            .||||||.|..|..|.||.: .|..|.|.||||.   .:||  .|.:.::.:|.|.:|.      
Human   181 VLILNDNLLSSLPNNLFRFV-PLTHLDLRGNRLKLLPYVGL--LQHMDKVVELQLEENPWNCSCE 242

  Fly   254 -------LDALRPN-VFGAV---QNFVLHLQQLD-LSGNRI---RLLFDNQFR------------ 291
                   ||::..: :.|.|   ..|.||.:.|| :|...:   ||:.|.:.|            
Human   243 LISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRRLISDYEMRPQTPLSTTGYLH 307

  Fly   292 ----------------------------------------------------------------- 291
                                                                             
Human   308 TTPASVNSVATSSSAVYKPPLKPPKGTRQPNKPRVRPTSRQPSKDLGYSNYGPSIAYQTKSPVPL 372

  Fly   292 -----VLARLQMLDVSRN---------SIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALL 342
                 ....||:.|:..|         |||.|.|..:    :.:|:||..|.|..::...|....
Human   373 ECPTACSCNLQISDLGLNVNCQERKIESIAELQPKPY----NPKKMYLTENYIAVVRRTDFLEAT 433

  Fly   343 NLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSL 407
            .||.|.|..|.:..::::.||  .|..:|||.|||||::.|.|..|..|..|:||.|.:|.::.:
Human   434 GLDLLHLGNNRISMIQDRAFG--DLTNLRRLYLNGNRIERLSPELFYGLQSLQYLFLQYNLIREI 496

  Fly   408 DVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNV--SFPNLKRVAI 470
            ....|.|:..||.|.|.:|||:.:...|...|:.:: :.:.:|..|.|....|  ...:|.::.:
Human   497 QSGTFDPVPNLQLLFLNNNLLQAMPSGVFSGLTLLR-LNLRSNHFTSLPVSGVLDQLKSLIQIDL 560

  Fly   471 EGNPWQCPC-FVKLQHWLATRDVVYLRD 497
            ..|||.|.| .|.::.|:....|..|.|
Human   561 HDNPWDCTCDIVGMKLWVEQLKVGVLVD 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 47/168 (28%)
LRR_8 104..164 CDD:290566 17/59 (29%)
leucine-rich repeat 106..129 CDD:275380 5/22 (23%)
leucine-rich repeat 130..153 CDD:275380 9/22 (41%)
leucine-rich repeat 154..195 CDD:275380 6/40 (15%)
LRR_RI 194..455 CDD:238064 93/375 (25%)
LRR_8 194..254 CDD:290566 26/75 (35%)
leucine-rich repeat 196..219 CDD:275380 13/22 (59%)
leucine-rich repeat 220..243 CDD:275380 10/25 (40%)
leucine-rich repeat 244..267 CDD:275380 7/39 (18%)
LRR_8 271..330 CDD:290566 21/153 (14%)
leucine-rich repeat 272..295 CDD:275380 7/108 (6%)
leucine-rich repeat 296..319 CDD:275380 9/31 (29%)
LRR_8 319..380 CDD:290566 21/60 (35%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 8/24 (33%)
LRR_8 368..428 CDD:290566 24/59 (41%)
leucine-rich repeat 370..393 CDD:275380 12/22 (55%)
leucine-rich repeat 394..417 CDD:275380 7/22 (32%)
leucine-rich repeat 418..441 CDD:275380 9/22 (41%)
SLITRK5NP_001371538.1 leucine-rich repeat 62..79 CDD:275380 0/16 (0%)
LRR <72..319 CDD:227223 65/267 (24%)
LRR 1 82..103 5/20 (25%)
leucine-rich repeat 83..106 CDD:275380 5/22 (23%)
LRR 2 106..127 5/20 (25%)
leucine-rich repeat 107..130 CDD:275380 5/22 (23%)
LRR_8 129..189 CDD:404697 23/77 (30%)
LRR 3 130..151 8/20 (40%)
leucine-rich repeat 131..154 CDD:275380 9/22 (41%)
LRR 4 154..175 5/38 (13%)
leucine-rich repeat 155..178 CDD:275380 6/40 (15%)
LRR 5 178..199 12/20 (60%)
leucine-rich repeat 179..200 CDD:275380 13/20 (65%)
LRR 6 201..222 9/22 (41%)
leucine-rich repeat 202..226 CDD:275380 10/25 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..358 0/40 (0%)
PPP1R42 391..>563 CDD:411060 52/178 (29%)
LRR 7 410..431 6/20 (30%)
LRR_8 433..493 CDD:404697 25/61 (41%)
LRR 8 434..455 7/22 (32%)
leucine-rich repeat 435..458 CDD:275378 8/24 (33%)
LRR 9 458..479 11/20 (55%)
leucine-rich repeat 459..482 CDD:275378 12/22 (55%)
LRR 10 482..503 6/20 (30%)
leucine-rich repeat 483..530 CDD:275378 16/46 (35%)
LRR 11 506..527 8/20 (40%)
LRR 12 529..550 4/21 (19%)
leucine-rich repeat 531..554 CDD:275378 4/23 (17%)
leucine-rich repeat 555..567 CDD:275378 4/11 (36%)
TPKR_C2 563..>599 CDD:417692 10/26 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 789..844
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.