| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_694992.2 | Gene: | LRRC57 / 255252 | HGNCID: | 26719 | Length: | 239 | Species: | Homo sapiens |
| Alignment Length: | 285 | Identity: | 67/285 - (23%) |
|---|---|---|---|
| Similarity: | 117/285 - (41%) | Gaps: | 83/285 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 219 GLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIR 283
Fly 284 LLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLD 348
Fly 349 LSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFA 413
Fly 414 PMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCP 478
Fly 479 CFVKLQHWLATRDVVYLRDNTGYYK 503 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 10/36 (28%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 57/235 (24%) | ||
| LRR_8 | 194..254 | CDD:290566 | 10/34 (29%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 67/285 (24%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 271..330 | CDD:290566 | 18/58 (31%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 319..380 | CDD:290566 | 13/60 (22%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 6/24 (25%) | ||
| LRR_8 | 368..428 | CDD:290566 | 11/59 (19%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 1/22 (5%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 7/22 (32%) | ||
| LRRC57 | NP_694992.2 | PRK15370 | <21..>211 | CDD:185268 | 60/253 (24%) |
| LRR 1 | 39..60 | 8/23 (35%) | |||
| leucine-rich repeat | 40..63 | CDD:275380 | 9/25 (36%) | ||
| LRR 2 | 63..84 | 7/22 (32%) | |||
| leucine-rich repeat | 64..86 | CDD:275380 | 7/22 (32%) | ||
| LRR 3 | 86..107 | 6/21 (29%) | |||
| leucine-rich repeat | 87..109 | CDD:275380 | 7/22 (32%) | ||
| LRR 4 | 109..131 | 6/22 (27%) | |||
| leucine-rich repeat | 110..132 | CDD:275380 | 7/22 (32%) | ||
| LRR 5 | 132..153 | 6/47 (13%) | |||
| leucine-rich repeat | 133..154 | CDD:275380 | 6/47 (13%) | ||
| LRR 6 | 154..175 | 5/22 (23%) | |||
| leucine-rich repeat | 155..177 | CDD:275380 | 5/23 (22%) | ||
| LRR 7 | 177..197 | 9/28 (32%) | |||
| leucine-rich repeat | 178..199 | CDD:275380 | 8/29 (28%) | ||
| LRR 8 | 202..222 | 7/47 (15%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||