DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and PHLPP1

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_919431.2 Gene:PHLPP1 / 23239 HGNCID:20610 Length:1717 Species:Homo sapiens


Alignment Length:640 Identity:120/640 - (18%)
Similarity:214/640 - (33%) Gaps:226/640 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQME----------LLDRDFFGNLRKLIYANFS 160
            :..::||.|.|..:..|.|..:. |..::...|.:.          |.:...|..|:.|   |.|
Human   639 ISSVDLSCCSLEHLPANLFYSQD-LTHLNLKQNFLRQNPSLPAARGLNELQRFTKLKSL---NLS 699

  Fly   161 HN-----ALKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQL-------------- 206
            :|     .|..|.:|.:..|| :.....|.|.|..||...||..:|:.|.|              
Human   700 NNHLGDFPLAVCSIPTLAELN-VSCNALRSVPAAVGVMHNLQTFLLDGNFLQSLPAELENMKQLS 763

  Fly   207 -IQLDVNAFRGLHGLLE-------LQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFG 263
             :.|..|.|..:..:||       |.:|||.:.::.|:..:.:..::.::|   .|:.:|..:..
Human   764 YLGLSFNEFTDIPEVLEKLTAVDKLCMSGNCVETLRLQALRKMPHIKHVDL---RLNVIRKLIAD 825

  Fly   264 AVQNFVLHLQQLDLSGNRI----RLLFDNQFRVL------------------------------- 293
            .| :|:.|:.||||..|::    .::|:| ..||                               
Human   826 EV-DFLQHVTQLDLRDNKLGDLDAMIFNN-IEVLHCERNQLVTLDICGYFLKALYASSNELVQLD 888

  Fly   294 ----------------------------ARLQMLDVSRNSIASLSPAHFVGLGSLRKLY------ 324
                                        .:|::||:..|.|..| ||......|||||.      
Human   889 VYPVPNYLSYMDVSRNRLENVPEWVCESRKLEVLDIGHNQICEL-PARLFCNSSLRKLLAGHNQL 952

  Fly   325 ----------------LQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRL 373
                            :|:|.:||:.|.......:|..|:.|.|.||.|........|...::.|
Human   953 ARLPERLERTSVEVLDVQHNQLLELPPNLLMKADSLRFLNASANKLESLPPATLSEETNSILQEL 1017

  Fly   374 NLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLE- 437
            .|..|.:........:..|.|:.|.:.:|.|:|......|.:..|:::.|..|.|:.|...::. 
Human  1018 YLTNNSLTDKCVPLLTGHPHLKILHMAYNRLQSFPASKMAKLEELEEIDLSGNKLKAIPTTIMNC 1082

  Fly   438 -------SLSSVQEILVDNNRLTFLAKVNVSF-------------PNLKRVAIEGNP-------- 474
                   :.|:..|:..:..:|..:..|::|.             |.|:.:.:.|||        
Human  1083 RRMHTVIAHSNCIEVFPEVMQLPEIKCVDLSCNELSEVTLPENLPPKLQELDLTGNPRLVLDHKT 1147

  Fly   475 --------------------------WQ-------------CPCFVKLQHWLATRDVVYLRDNTG 500
                                      |.             |...:.:.::...|:.:|     |
Human  1148 LELLNNIRCFKIDQPSTGDASGAPAVWSHGYTEASGVKNKLCVAALSVNNFCDNREALY-----G 1207

  Fly   501 YYKGERPL-------CIVTNV------------DYCIQNLQAV-RRLGILGDFQG 535
            .:.|:|.:       |.::::            :|.:.....: |:||..|...|
Human  1208 VFDGDRNVEVPYLLQCTMSDILAEELQKTKNEEEYMVNTFIVMQRKLGTAGQKLG 1262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 42/186 (23%)
LRR_8 104..164 CDD:290566 15/72 (21%)
leucine-rich repeat 106..129 CDD:275380 6/22 (27%)
leucine-rich repeat 130..153 CDD:275380 5/32 (16%)
leucine-rich repeat 154..195 CDD:275380 14/45 (31%)
LRR_RI 194..455 CDD:238064 74/375 (20%)
LRR_8 194..254 CDD:290566 16/81 (20%)
leucine-rich repeat 196..219 CDD:275380 8/37 (22%)
leucine-rich repeat 220..243 CDD:275380 7/29 (24%)
leucine-rich repeat 244..267 CDD:275380 4/22 (18%)
LRR_8 271..330 CDD:290566 25/143 (17%)
leucine-rich repeat 272..295 CDD:275380 9/85 (11%)
leucine-rich repeat 296..319 CDD:275380 8/22 (36%)
LRR_8 319..380 CDD:290566 21/82 (26%)
leucine-rich repeat 320..343 CDD:275380 9/44 (20%)
leucine-rich repeat 344..369 CDD:275380 8/24 (33%)
LRR_8 368..428 CDD:290566 13/59 (22%)
leucine-rich repeat 370..393 CDD:275380 3/22 (14%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..441 CDD:275380 5/30 (17%)
PHLPP1NP_919431.2 leucine-rich repeat 1107..1129 CDD:275380 2/21 (10%)
PP2Cc 1168..1420 CDD:214625 14/100 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1458..1510
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1673..1717
PDZ-binding, required for interaction with SLC9A3R1. /evidence=ECO:0000269|PubMed:21804599 1715..1717
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..118
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..156
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..470
PH_PHLPP-like 535..631 CDD:270131
PH 555..636 CDD:278594
LRR_RI 625..929 CDD:238064 59/299 (20%)
LRR_8 638..703 CDD:290566 15/67 (22%)
LRR 1 638..659 6/19 (32%)
leucine-rich repeat 641..661 CDD:275380 6/19 (32%)
LRR 2 661..682 2/21 (10%)
leucine-rich repeat 662..692 CDD:275380 4/29 (14%)
LRR 3 692..712 6/22 (27%)
leucine-rich repeat 693..738 CDD:275380 15/48 (31%)
LRR_8 714..770 CDD:290566 14/56 (25%)
LRR 4 715..736 6/21 (29%)
LRR 5 738..760 5/21 (24%)
leucine-rich repeat 739..761 CDD:275380 5/21 (24%)
LRR 6 761..783 5/21 (24%)
leucine-rich repeat 762..784 CDD:275380 5/21 (24%)
LRR 7 784..804 5/19 (26%)
leucine-rich repeat 785..808 CDD:275380 5/22 (23%)
LRR 8 808..831 5/26 (19%)
leucine-rich repeat 810..832 CDD:275380 5/25 (20%)
LRR_RI 814..1074 CDD:238064 55/265 (21%)
LRR 9 832..853 7/20 (35%)
leucine-rich repeat 833..853 CDD:275380 6/19 (32%)
leucine-rich repeat 854..895 CDD:275380 2/40 (5%)
LRR 10 873..894 0/20 (0%)
LRR 11 895..916 0/20 (0%)
leucine-rich repeat 896..918 CDD:275380 0/21 (0%)
LRR 12 918..939 8/21 (38%)
leucine-rich repeat 919..941 CDD:275380 8/22 (36%)
LRR 13 941..962 5/20 (25%)
leucine-rich repeat 942..963 CDD:275380 4/20 (20%)
LRR_8 962..1024 CDD:290566 16/61 (26%)
LRR 14 963..984 5/20 (25%)
leucine-rich repeat 964..987 CDD:275380 5/22 (23%)
LRR 15 987..1008 7/20 (35%)
leucine-rich repeat 988..1011 CDD:275380 7/22 (32%)
LRR 16 1013..1033 3/19 (16%)
LRR_8 1014..1072 CDD:290566 13/57 (23%)
leucine-rich repeat 1014..1037 CDD:275380 3/22 (14%)
LRR 17 1037..1058 5/20 (25%)
leucine-rich repeat 1038..1061 CDD:275380 6/22 (27%)
LRR 18 1061..1082 5/20 (25%)
Interaction with SLC9A3R1. /evidence=ECO:0000269|PubMed:21804599 1076..1205 13/128 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.