DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and Lrrc26

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_666229.1 Gene:Lrrc26 / 227618 MGIID:2385129 Length:331 Species:Mus musculus


Alignment Length:237 Identity:61/237 - (25%)
Similarity:94/237 - (39%) Gaps:70/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 LRKLYLQYNAILEIKPATFA---ALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMK 381
            :|.|.|.:|.:..:.|..||   |||.||                             |..||::
Mouse    73 VRSLLLDHNRVSALPPGAFANAGALLYLD-----------------------------LRENRLR 108

  Fly   382 HLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEIL 446
            .:|..||..|..|::|.|..|:|::|....|||:|.|..|.|..|.|..:...:|..|..::.:.
Mouse   109 SVHARAFWGLGVLQWLDLSSNQLETLPPGTFAPLRALSFLSLAGNRLALLEPSILGPLPLLRVLS 173

  Fly   447 VDNNRLTFL-AKVNVSFPNLKRVAIEGNPWQCPCFVK-LQHWLATRDVVYLRDNTGYYKGERP-- 507
            :.:|.|:.: |.:..:.|.|..:.:.||||.|.|.:: |..||.              |..||  
Mouse   174 LQDNSLSAIEAGLLNNLPALDVLRLHGNPWTCNCALRPLCTWLR--------------KHPRPAS 224

  Fly   508 -----LCIVTNVD--------------YCIQNLQAVRRLGIL 530
                 ||:...:.              .|.|:| |.|.|.::
Mouse   225 ETETLLCVSPRLQTLSLLTAFPDAAFKQCTQSL-AARDLAVV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 38/137 (28%)
LRR_8 194..254 CDD:290566
leucine-rich repeat 196..219 CDD:275380
leucine-rich repeat 220..243 CDD:275380
leucine-rich repeat 244..267 CDD:275380
LRR_8 271..330 CDD:290566 4/9 (44%)
leucine-rich repeat 272..295 CDD:275380
leucine-rich repeat 296..319 CDD:275380
LRR_8 319..380 CDD:290566 14/62 (23%)
leucine-rich repeat 320..343 CDD:275380 9/25 (36%)
leucine-rich repeat 344..369 CDD:275380 2/24 (8%)
LRR_8 368..428 CDD:290566 21/59 (36%)
leucine-rich repeat 370..393 CDD:275380 7/22 (32%)
leucine-rich repeat 394..417 CDD:275380 9/22 (41%)
leucine-rich repeat 418..441 CDD:275380 7/22 (32%)
Lrrc26NP_666229.1 LRR_8 72..131 CDD:290566 23/86 (27%)
LRR 1 72..93 6/19 (32%)
leucine-rich repeat 73..96 CDD:275380 7/22 (32%)
LRR 2 96..117 11/49 (22%)
leucine-rich repeat 97..120 CDD:275380 11/51 (22%)
LRR 118..141 CDD:197688 8/22 (36%)
LRR 3 120..141 7/20 (35%)
LRR_8 121..179 CDD:290566 18/57 (32%)
leucine-rich repeat 121..144 CDD:275380 9/22 (41%)
LRR 4 144..165 6/20 (30%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
LRR 5 168..191 3/22 (14%)
LRR_4 169..204 CDD:289563 8/34 (24%)
leucine-rich repeat 169..192 CDD:275380 3/22 (14%)
TPKR_C2 201..244 CDD:301599 13/56 (23%)
leucine-rich repeat 236..255 CDD:275380 1/18 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7602
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.