| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_666229.1 | Gene: | Lrrc26 / 227618 | MGIID: | 2385129 | Length: | 331 | Species: | Mus musculus |
| Alignment Length: | 237 | Identity: | 61/237 - (25%) |
|---|---|---|---|
| Similarity: | 94/237 - (39%) | Gaps: | 70/237 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 320 LRKLYLQYNAILEIKPATFA---ALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMK 381
Fly 382 HLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEIL 446
Fly 447 VDNNRLTFL-AKVNVSFPNLKRVAIEGNPWQCPCFVK-LQHWLATRDVVYLRDNTGYYKGERP-- 507
Fly 508 -----LCIVTNVD--------------YCIQNLQAVRRLGIL 530 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 38/137 (28%) | ||
| LRR_8 | 194..254 | CDD:290566 | |||
| leucine-rich repeat | 196..219 | CDD:275380 | |||
| leucine-rich repeat | 220..243 | CDD:275380 | |||
| leucine-rich repeat | 244..267 | CDD:275380 | |||
| LRR_8 | 271..330 | CDD:290566 | 4/9 (44%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | |||
| leucine-rich repeat | 296..319 | CDD:275380 | |||
| LRR_8 | 319..380 | CDD:290566 | 14/62 (23%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 9/25 (36%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 2/24 (8%) | ||
| LRR_8 | 368..428 | CDD:290566 | 21/59 (36%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 7/22 (32%) | ||
| Lrrc26 | NP_666229.1 | LRR_8 | 72..131 | CDD:290566 | 23/86 (27%) |
| LRR 1 | 72..93 | 6/19 (32%) | |||
| leucine-rich repeat | 73..96 | CDD:275380 | 7/22 (32%) | ||
| LRR 2 | 96..117 | 11/49 (22%) | |||
| leucine-rich repeat | 97..120 | CDD:275380 | 11/51 (22%) | ||
| LRR | 118..141 | CDD:197688 | 8/22 (36%) | ||
| LRR 3 | 120..141 | 7/20 (35%) | |||
| LRR_8 | 121..179 | CDD:290566 | 18/57 (32%) | ||
| leucine-rich repeat | 121..144 | CDD:275380 | 9/22 (41%) | ||
| LRR 4 | 144..165 | 6/20 (30%) | |||
| leucine-rich repeat | 145..168 | CDD:275380 | 7/22 (32%) | ||
| LRR 5 | 168..191 | 3/22 (14%) | |||
| LRR_4 | 169..204 | CDD:289563 | 8/34 (24%) | ||
| leucine-rich repeat | 169..192 | CDD:275380 | 3/22 (14%) | ||
| TPKR_C2 | 201..244 | CDD:301599 | 13/56 (23%) | ||
| leucine-rich repeat | 236..255 | CDD:275380 | 1/18 (6%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 310..331 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X7602 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||