DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6749 and pxn-1

DIOPT Version :9

Sequence 1:	NP_648354.1	Gene:	CG6749 / 39144	FlyBaseID:	FBgn0036040	Length:	552	Species:	Drosophila melanogaster
Sequence 2:	NP_505188.3	Gene:	pxn-1 / 191484	WormBaseID:	WBGene00004256	Length:	1285	Species:	Caenorhabditis elegans

Alignment Length:	180	Identity:	42/180 - (23%)
Similarity:	77/180 - (42%)	Gaps:	41/180 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly   300 DVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGG 364
            ::|||               :|.|.::.|.|.::|.:.......|:||.|::|.::.:||.:.
Worm    49 NISRN---------------VRSLVIRNNRIHKLKRSDLEGFNQLETLVLTHNKIKIIEENVL-- 96

  Fly   365 NTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLE 429
            :.||.::||:|..|.:.::.||...|.| |..|.|..|.::.:|.::......|.:|...||.::
Worm    97 DHLPELKRLSLAHNELVYIPPLCSDSRP-LASLNLKRNHIQFIDEQVLRYFPDLTQLDFSHNRIQ 160

  Fly   430 EINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPC 479
            .:...:.::|                       |.|....:..|||.|.|
Worm   161 SLRTKLFDNL-----------------------PALSHAHLHSNPWHCDC 187

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6749	NP_648354.1	LRR_RI	103..>256	CDD:238064
		LRR_8	104..164	CDD:290566
		leucine-rich repeat	106..129	CDD:275380
		leucine-rich repeat	130..153	CDD:275380
		leucine-rich repeat	154..195	CDD:275380
		LRR_RI	194..455	CDD:238064	35/154 (23%)
		LRR_8	194..254	CDD:290566
		leucine-rich repeat	196..219	CDD:275380
		leucine-rich repeat	220..243	CDD:275380
		leucine-rich repeat	244..267	CDD:275380
		LRR_8	271..330	CDD:290566	6/29 (21%)
		leucine-rich repeat	272..295	CDD:275380
		leucine-rich repeat	296..319	CDD:275380	3/18 (17%)
		LRR_8	319..380	CDD:290566	18/60 (30%)
		leucine-rich repeat	320..343	CDD:275380	5/22 (23%)
		leucine-rich repeat	344..369	CDD:275380	8/24 (33%)
		LRR_8	368..428	CDD:290566	18/59 (31%)
		leucine-rich repeat	370..393	CDD:275380	7/22 (32%)
		leucine-rich repeat	394..417	CDD:275380	5/22 (23%)
		leucine-rich repeat	418..441	CDD:275380	5/22 (23%)
pxn-1	NP_505188.3	LRRNT	23..51	CDD:279764	0/1 (0%)
		leucine-rich repeat	35..53	CDD:275380	1/3 (33%)
		LRR_8	52..112	CDD:290566	20/76 (26%)
		LRR_4	53..93	CDD:289563	11/54 (20%)
		leucine-rich repeat	54..77	CDD:275380	5/22 (23%)
		LRR_4	77..120	CDD:289563	15/44 (34%)
		leucine-rich repeat	78..101	CDD:275380	8/24 (33%)
		leucine-rich repeat	102..117	CDD:275380	4/14 (29%)
		LRR_8	123..182	CDD:290566	13/82 (16%)
		leucine-rich repeat	125..148	CDD:275380	5/22 (23%)
		leucine-rich repeat	149..172	CDD:275380	5/45 (11%)
		I-set	315..400	CDD:254352
		IGc2	328..392	CDD:197706
		IG_like	414..496	CDD:214653
		Ig	420..496	CDD:299845
		An_peroxidase	634..1181	CDD:281139
		peroxidasin_like	757..1203	CDD:188658
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910