Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001337270.1 | Gene: | phlp-2 / 185690 | WormBaseID: | WBGene00009647 | Length: | 1126 | Species: | Caenorhabditis elegans |
Alignment Length: | 501 | Identity: | 116/501 - (23%) |
---|---|---|---|
Similarity: | 180/501 - (35%) | Gaps: | 164/501 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 104 PNLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNAL---- 164
Fly 165 ----KQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQL 225
Fly 226 SGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQN------------------FVLHL 272
Fly 273 QQLDLSGNRI-----------------RLLFDNQFRV-LARLQMLDVSRNSIAS----------- 308
Fly 309 --------LSPAHFVGLGSLRKLYLQYNAI--LEIKPATFAALLNLDTLDLSYN----------- 352
Fly 353 --NLEFLE----------EQIFGGNT--------------------------------------- 366
Fly 367 ----LPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNL 427
Fly 428 LEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGN 473 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 38/159 (24%) |
LRR_8 | 104..164 | CDD:290566 | 13/59 (22%) | ||
leucine-rich repeat | 106..129 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 130..153 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 154..195 | CDD:275380 | 6/48 (13%) | ||
LRR_RI | 194..455 | CDD:238064 | 94/383 (25%) | ||
LRR_8 | 194..254 | CDD:290566 | 20/59 (34%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 220..243 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 244..267 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 271..330 | CDD:290566 | 22/95 (23%) | ||
leucine-rich repeat | 272..295 | CDD:275380 | 9/40 (23%) | ||
leucine-rich repeat | 296..319 | CDD:275380 | 9/41 (22%) | ||
LRR_8 | 319..380 | CDD:290566 | 27/128 (21%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | 5/24 (21%) | ||
leucine-rich repeat | 344..369 | CDD:275380 | 14/90 (16%) | ||
LRR_8 | 368..428 | CDD:290566 | 19/59 (32%) | ||
leucine-rich repeat | 370..393 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 394..417 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 418..441 | CDD:275380 | 8/22 (36%) | ||
phlp-2 | NP_001337270.1 | leucine-rich repeat | 232..253 | CDD:275380 | 6/29 (21%) |
leucine-rich repeat | 254..288 | CDD:275380 | 6/48 (13%) | ||
PLN00113 | 283..>718 | CDD:331614 | 101/422 (24%) | ||
leucine-rich repeat | 289..311 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 312..334 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 335..357 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 358..379 | CDD:275380 | 1/20 (5%) | ||
leucine-rich repeat | 380..440 | CDD:275380 | 14/59 (24%) | ||
leucine-rich repeat | 441..485 | CDD:275380 | 10/48 (21%) | ||
leucine-rich repeat | 486..508 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 509..534 | CDD:275380 | 6/24 (25%) | ||
leucine-rich repeat | 554..577 | CDD:275380 | 1/22 (5%) | ||
leucine-rich repeat | 578..602 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 603..625 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 626..649 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 650..672 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 673..694 | CDD:275380 | 2/9 (22%) | ||
PP2Cc | 754..985 | CDD:214625 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |