DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and phlp-2

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001337270.1 Gene:phlp-2 / 185690 WormBaseID:WBGene00009647 Length:1126 Species:Caenorhabditis elegans


Alignment Length:501 Identity:116/501 - (23%)
Similarity:180/501 - (35%) Gaps:164/501 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PNLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNAL---- 164
            ||:.:..|:....|: :.||         :|.|..|:.|:......|..::...|...|:|    
 Worm   214 PNILEAWLTRAQQVE-KSNH---------VDASDEQLTLIPEQILNNEARVQILNLRRNSLISRP 268

  Fly   165 ----KQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQL 225
                ....|.::..|.|:.               .||.:.|:.||::...:......| |.:|.|
 Worm   269 PTEKSMAPLGYIDDLYRVH---------------SLQVIDLSANQILSFPIQLTLLSH-LRQLNL 317

  Fly   226 SGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQN------------------FVLHL 272
            |.|.:||:..|. ..:.:|:.||||.|.||.| |:....:||                  |.|.|
 Worm   318 SSNYISSVPSEC-SNMRRLQYLNLSNNQLDTL-PDSISELQNLQSLDISFNQFSQIPPCLFHLTL 380

  Fly   273 QQLDLSGNRI-----------------RLLFDNQFRV-LARLQMLDVSRNSIAS----------- 308
            :...|:||.|                 |.:.|..||: :..:..||:..||:.|           
 Worm   381 EMWRLAGNNIEKIDRVGEMQIQKIDLRRNVLDTSFRLDIENITHLDLRDNSMISTVHLTNLRFLK 445

  Fly   309 --------LSPAHFVGLGSLRKLYLQYNAI--LEIKPATFAALLNLDTLDLSYN----------- 352
                    ||..|..| .||..:|..:|.:  |.:.|..    .||.||.||:|           
 Worm   446 VIHCERLQLSSLHLSG-ESLTHVYADHNLLDSLVVMPLP----QNLQTLSLSFNHFRNLPDWISD 505

  Fly   353 --NLEFLE----------EQIFGGNT--------------------------------------- 366
              ||.||.          |:||...:                                       
 Worm   506 CPNLTFLRANNNSLVALPERIFYSQSLRSIFAFINEIEHIPDFGEENCLETLILYKNKLSSLPKH 570

  Fly   367 ----LPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNL 427
                |||:|:||::.|.::.|.....||...|:.|:..:|.|....|.:...|:.|:.:.|.||.
 Worm   571 FFSILPRLRQLNISSNFIELLPYFDGSSFCRLQILRCANNYLTENSVPVIVNMKHLKIIDLSHNR 635

  Fly   428 LEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGN 473
            |...:...|.||..::::.:.:||||.||......|.|:.:....|
 Worm   636 LNSFDDSALSSLELLEDLNLSSNRLTRLADCLALLPCLQVLRAHSN 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 38/159 (24%)
LRR_8 104..164 CDD:290566 13/59 (22%)
leucine-rich repeat 106..129 CDD:275380 4/22 (18%)
leucine-rich repeat 130..153 CDD:275380 5/22 (23%)
leucine-rich repeat 154..195 CDD:275380 6/48 (13%)
LRR_RI 194..455 CDD:238064 94/383 (25%)
LRR_8 194..254 CDD:290566 20/59 (34%)
leucine-rich repeat 196..219 CDD:275380 5/22 (23%)
leucine-rich repeat 220..243 CDD:275380 8/22 (36%)
leucine-rich repeat 244..267 CDD:275380 10/22 (45%)
LRR_8 271..330 CDD:290566 22/95 (23%)
leucine-rich repeat 272..295 CDD:275380 9/40 (23%)
leucine-rich repeat 296..319 CDD:275380 9/41 (22%)
LRR_8 319..380 CDD:290566 27/128 (21%)
leucine-rich repeat 320..343 CDD:275380 5/24 (21%)
leucine-rich repeat 344..369 CDD:275380 14/90 (16%)
LRR_8 368..428 CDD:290566 19/59 (32%)
leucine-rich repeat 370..393 CDD:275380 7/22 (32%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..441 CDD:275380 8/22 (36%)
phlp-2NP_001337270.1 leucine-rich repeat 232..253 CDD:275380 6/29 (21%)
leucine-rich repeat 254..288 CDD:275380 6/48 (13%)
PLN00113 283..>718 CDD:331614 101/422 (24%)
leucine-rich repeat 289..311 CDD:275380 5/21 (24%)
leucine-rich repeat 312..334 CDD:275380 8/22 (36%)
leucine-rich repeat 335..357 CDD:275380 10/22 (45%)
leucine-rich repeat 358..379 CDD:275380 1/20 (5%)
leucine-rich repeat 380..440 CDD:275380 14/59 (24%)
leucine-rich repeat 441..485 CDD:275380 10/48 (21%)
leucine-rich repeat 486..508 CDD:275380 6/21 (29%)
leucine-rich repeat 509..534 CDD:275380 6/24 (25%)
leucine-rich repeat 554..577 CDD:275380 1/22 (5%)
leucine-rich repeat 578..602 CDD:275380 7/23 (30%)
leucine-rich repeat 603..625 CDD:275380 5/21 (24%)
leucine-rich repeat 626..649 CDD:275380 8/22 (36%)
leucine-rich repeat 650..672 CDD:275380 6/21 (29%)
leucine-rich repeat 673..694 CDD:275380 2/9 (22%)
PP2Cc 754..985 CDD:214625
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.