DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and lron-4

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001309442.1 Gene:lron-4 / 183375 WormBaseID:WBGene00008051 Length:633 Species:Caenorhabditis elegans


Alignment Length:348 Identity:77/348 - (22%)
Similarity:135/348 - (38%) Gaps:92/348 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 APINVHTNGF----SILPNLRQLNLSGCGLVDIRGNHFAPESA---LQRIDFSHNQMELL----- 143
            ||..:.|:.|    |.:|:|:.|:||   :::|.|....||..   |:.|.|...:|..:     
 Worm   255 APRFIPTSKFWATLSKIPSLKSLSLS---VIEITGKEDIPEGMTRNLRSIGFYDVKMNSIPNWIK 316

  Fly   144 -DRDFFGNLRKLIYANFSHNALKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLI 207
             |:..|...:..|..|...:||.:                          .|.|:..:|.::.|.
 Worm   317 TDQIQFLEFQSSISDNVDMSALDE--------------------------LPTLEHFLLTESSLT 355

  Fly   208 QLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQN-FVLH 271
            .:..........|:.|.|..|.:|||....|....:|:.|||:.|.:.:|..|:...:.| .||.
 Worm   356 SIKSPFLSKSSKLISLTLQCNSISSIAAGAFDHFTELQFLNLAGNRIASLPSNLLLNLNNLIVLD 420

  Fly   272 LQQLDLSGNRIRLLFDNQFRVLARL------------QMLDVS--------------------RN 304
            |:.||.|.|.|...  |:..:..::            :|.|||                    ::
 Worm   421 LKALDNSSNTIGTY--NELSMQCQINQKASTVPVILDKMPDVSKPEKLVALEIRGQENIMKNDKS 483

  Fly   305 SIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPR 369
            .:.:......:.||:|..|..| |..||    |...|::|:.:....::.:::.|.:|       
 Worm   484 FLKNFKNLEILNLGNLGLLSAQ-NLSLE----TLCNLIDLNLVGNPLSDKDWISEDLF------- 536

  Fly   370 MRRLNLNGNRMKHLHPLAFSSLP 392
               :|||..|::...|.:.:|:|
 Worm   537 ---VNLNLQRLRMGQPSSMTSIP 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 36/161 (22%)
LRR_8 104..164 CDD:290566 17/68 (25%)
leucine-rich repeat 106..129 CDD:275380 8/22 (36%)
leucine-rich repeat 130..153 CDD:275380 6/28 (21%)
leucine-rich repeat 154..195 CDD:275380 4/40 (10%)
LRR_RI 194..455 CDD:238064 53/232 (23%)
LRR_8 194..254 CDD:290566 17/59 (29%)
leucine-rich repeat 196..219 CDD:275380 3/22 (14%)
leucine-rich repeat 220..243 CDD:275380 8/22 (36%)
leucine-rich repeat 244..267 CDD:275380 7/22 (32%)
LRR_8 271..330 CDD:290566 17/90 (19%)
leucine-rich repeat 272..295 CDD:275380 7/22 (32%)
leucine-rich repeat 296..319 CDD:275380 5/54 (9%)
LRR_8 319..380 CDD:290566 14/60 (23%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..369 CDD:275380 3/24 (13%)
LRR_8 368..428 CDD:290566 7/25 (28%)
leucine-rich repeat 370..393 CDD:275380 7/23 (30%)
leucine-rich repeat 394..417 CDD:275380
leucine-rich repeat 418..441 CDD:275380
lron-4NP_001309442.1 leucine-rich repeat 274..300 CDD:275378 9/28 (32%)
leucine-rich repeat 301..343 CDD:275378 9/67 (13%)
LRR_8 342..402 CDD:290566 17/59 (29%)
leucine-rich repeat 344..367 CDD:275378 3/22 (14%)
leucine-rich repeat 368..391 CDD:275378 8/22 (36%)
leucine-rich repeat 392..404 CDD:275378 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.