Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510424.4 | Gene: | lron-1 / 181553 | WormBaseID: | WBGene00008093 | Length: | 607 | Species: | Caenorhabditis elegans |
Alignment Length: | 403 | Identity: | 91/403 - (22%) |
---|---|---|---|
Similarity: | 148/403 - (36%) | Gaps: | 135/403 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 195 QLQELILNDNQLIQLDVNAFRG--LHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDAL 257
Fly 258 RPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRK 322
Fly 323 LYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLA 387
Fly 388 FSSLPFLEYLKLGHNELKSLDVRMF---------------------------------------- 412
Fly 413 --AP----------------------MRRLQKLHLGHNLLEEINLDVLESLSSVQEI-------- 445
Fly 446 LVD----------------NNRLTFLAKVNVSFPNL---------KRVAIEGNPWQCPCFVKLQH 485
Fly 486 WLATRDVVYLRDN 498 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 20/62 (32%) |
LRR_8 | 104..164 | CDD:290566 | |||
leucine-rich repeat | 106..129 | CDD:275380 | |||
leucine-rich repeat | 130..153 | CDD:275380 | |||
leucine-rich repeat | 154..195 | CDD:275380 | 91/403 (23%) | ||
LRR_RI | 194..455 | CDD:238064 | 75/349 (21%) | ||
LRR_8 | 194..254 | CDD:290566 | 20/60 (33%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 220..243 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 244..267 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 271..330 | CDD:290566 | 13/58 (22%) | ||
leucine-rich repeat | 272..295 | CDD:275380 | 1/22 (5%) | ||
leucine-rich repeat | 296..319 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 319..380 | CDD:290566 | 15/60 (25%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 344..369 | CDD:275380 | 5/24 (21%) | ||
LRR_8 | 368..428 | CDD:290566 | 23/123 (19%) | ||
leucine-rich repeat | 370..393 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 394..417 | CDD:275380 | 13/86 (15%) | ||
leucine-rich repeat | 418..441 | CDD:275380 | 6/22 (27%) | ||
lron-1 | NP_510424.4 | PRK15370 | <58..>289 | CDD:185268 | 61/233 (26%) |
leucine-rich repeat | 85..109 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 110..133 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 134..157 | CDD:275380 | 7/29 (24%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 209..231 | CDD:275380 | 5/24 (21%) | ||
leucine-rich repeat | 232..255 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 256..279 | CDD:275380 | 11/22 (50%) | ||
leucine-rich repeat | 280..319 | CDD:275380 | 1/38 (3%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | 0/22 (0%) | ||
LRR_8 | 343..402 | CDD:338972 | 10/58 (17%) | ||
leucine-rich repeat | 344..367 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 368..391 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 392..410 | CDD:275380 | 5/18 (28%) | ||
leucine-rich repeat | 414..435 | CDD:275378 | 5/20 (25%) | ||
LRRCT | 431..>472 | CDD:214507 | 11/26 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |