DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and pxn-2

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_509834.1 Gene:pxn-2 / 181288 WormBaseID:WBGene00004257 Length:1328 Species:Caenorhabditis elegans


Alignment Length:238 Identity:58/238 - (24%)
Similarity:95/238 - (39%) Gaps:63/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 LYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLA 387
            ||...|.:..:..:.|.||.||..||||.|::..:||.:                          
 Worm    49 LYFSNNLLNSLSKSNFQALPNLQYLDLSNNSIRDIEETL-------------------------- 87

  Fly   388 FSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRL 452
            ..|.|.|:||.|..|:::.:.....|| ..|..|:|.||.:..::.|::.....:|..|:..||:
 Worm    88 LDSFPGLKYLDLSWNKIRYVPKLSTAP-NALVSLNLVHNEISRLDNDLVSHSPYMQTFLIQRNRI 151

  Fly   453 T------FLAKVNVSFPNLKRVAIEGNPWQCPC-FVKLQHWLATRDVVYLRDNTGYY-------- 502
            .      |.:::   .|.||.|.:.||||.|.| .|.::.:   .|.::...|...:        
 Worm   152 QSLPHDFFNSRM---VPTLKTVKMAGNPWSCDCRMVNVKQF---ADSLFAHSNQNIFIVGKCFFP 210

  Fly   503 KGERPLCIVTNVDYCIQNLQAVRRLGILGDFQGEQVEADAFDD 545
            ||.|        :|..:||.       :.:.:.|:.|....||
 Worm   211 KGLR--------NYVFRNLS-------IENLECEKPEYSKTDD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 34/137 (25%)
LRR_8 194..254 CDD:290566
leucine-rich repeat 196..219 CDD:275380
leucine-rich repeat 220..243 CDD:275380
leucine-rich repeat 244..267 CDD:275380
LRR_8 271..330 CDD:290566 3/6 (50%)
leucine-rich repeat 272..295 CDD:275380
leucine-rich repeat 296..319 CDD:275380
LRR_8 319..380 CDD:290566 15/56 (27%)
leucine-rich repeat 320..343 CDD:275380 6/19 (32%)
leucine-rich repeat 344..369 CDD:275380 8/24 (33%)
LRR_8 368..428 CDD:290566 14/59 (24%)
leucine-rich repeat 370..393 CDD:275380 1/22 (5%)
leucine-rich repeat 394..417 CDD:275380 7/22 (32%)
leucine-rich repeat 418..441 CDD:275380 6/22 (27%)
pxn-2NP_509834.1 LRRNT 16..43 CDD:396168
leucine-rich repeat 28..44 CDD:275380
PRK15370 <35..>155 CDD:185268 34/132 (26%)
leucine-rich repeat 46..69 CDD:275378 6/19 (32%)
LRR_8 47..104 CDD:404697 22/80 (28%)
leucine-rich repeat 70..93 CDD:275378 9/48 (19%)
leucine-rich repeat 94..116 CDD:275378 7/22 (32%)
leucine-rich repeat 117..140 CDD:275378 6/22 (27%)
leucine-rich repeat 141..154 CDD:275378 4/12 (33%)
Ig 346..432 CDD:416386
Ig strand B 369..373 CDD:409353
Ig strand C 382..386 CDD:409353
Ig strand E 405..410 CDD:409353
Ig strand F 419..424 CDD:409353
I-set 445..533 CDD:400151
Ig strand A' 453..457 CDD:409353
Ig strand B 460..469 CDD:409353
Ig strand C 475..480 CDD:409353
Ig strand C' 483..486 CDD:409353
Ig strand D 491..496 CDD:409353
Ig strand E 497..505 CDD:409353
Ig strand F 512..520 CDD:409353
Ig strand G 523..533 CDD:409353
peroxidasin_like 798..1238 CDD:188658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.