DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and iglr-3

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001293349.1 Gene:iglr-3 / 171771 WormBaseID:WBGene00021353 Length:488 Species:Caenorhabditis elegans


Alignment Length:179 Identity:58/179 - (32%)
Similarity:83/179 - (46%) Gaps:41/179 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 QPLAQLRKLNLSQNALDALR--PNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDV 301
            |.|..:..|:||.|::..:.  |:.:..:|:  |.|.|..|.    :|.|| ...|..:|:.|||
 Worm    46 QLLPNVLSLSLSNNSIFRITTFPSEYRRLQS--LRLDQCQLE----KLDFD-ALSVFEQLRELDV 103

  Fly   302 SRNSIASL-SPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGN 365
            ||||::.| .|.:   |.|||.|.|.:||...:...:....|.|  :|||:|.|.         :
 Worm   104 SRNSLSKLIIPRN---LASLRVLNLAFNAFTYVPDMSHLESLRL--VDLSHNRLI---------S 154

  Fly   366 TLPRMRRLNLN-----GNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDV 409
            ..|||...||.     .||.:||.|     .|||       ::|:.|||
 Worm   155 VRPRMLPFNLEVVRLAANRFQHLSP-----WPFL-------HKLQELDV 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 6/16 (38%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 58/179 (32%)
LRR_8 194..254 CDD:290566 6/14 (43%)
leucine-rich repeat 196..219 CDD:275380
leucine-rich repeat 220..243 CDD:275380 2/3 (67%)
leucine-rich repeat 244..267 CDD:275380 5/24 (21%)
LRR_8 271..330 CDD:290566 24/59 (41%)
leucine-rich repeat 272..295 CDD:275380 7/22 (32%)
leucine-rich repeat 296..319 CDD:275380 11/23 (48%)
LRR_8 319..380 CDD:290566 20/65 (31%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 6/24 (25%)
LRR_8 368..428 CDD:290566 17/47 (36%)
leucine-rich repeat 370..393 CDD:275380 8/27 (30%)
leucine-rich repeat 394..417 CDD:275380 5/16 (31%)
leucine-rich repeat 418..441 CDD:275380
iglr-3NP_001293349.1 LRR <47..>196 CDD:227223 57/178 (32%)
leucine-rich repeat 51..73 CDD:275380 5/21 (24%)
leucine-rich repeat 74..97 CDD:275380 9/29 (31%)
leucine-rich repeat 98..119 CDD:275380 11/23 (48%)
leucine-rich repeat 120..141 CDD:275380 6/20 (30%)
leucine-rich repeat 142..163 CDD:275380 10/31 (32%)
leucine-rich repeat 164..185 CDD:275380 9/32 (28%)
Ig_3 243..319 CDD:372822
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.