| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001333102.1 | Gene: | LRFN5 / 145581 | HGNCID: | 20360 | Length: | 719 | Species: | Homo sapiens |
| Alignment Length: | 259 | Identity: | 61/259 - (23%) |
|---|---|---|---|
| Similarity: | 104/259 - (40%) | Gaps: | 66/259 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 221 LELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLL 285
Fly 286 FDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLS 350
Fly 351 YNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPM 415
Fly 416 RRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPC 479 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 11/34 (32%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 53/233 (23%) | ||
| LRR_8 | 194..254 | CDD:290566 | 11/32 (34%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | |||
| leucine-rich repeat | 220..243 | CDD:275380 | 6/21 (29%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 271..330 | CDD:290566 | 12/58 (21%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 2/22 (9%) | ||
| LRR_8 | 319..380 | CDD:290566 | 18/60 (30%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 11/24 (46%) | ||
| LRR_8 | 368..428 | CDD:290566 | 10/59 (17%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 1/22 (5%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 5/22 (23%) | ||
| LRFN5 | NP_001333102.1 | LRR 1 | 52..73 | 6/18 (33%) | |
| LRR 2 | 76..97 | 7/20 (35%) | |||
| LRR 3 | 100..121 | 7/48 (15%) | |||
| LRR 4 | 124..145 | 6/20 (30%) | |||
| LRR 5 | 148..169 | 13/46 (28%) | |||
| LRR 6 | 172..193 | 6/20 (30%) | |||
| LRR 7 | 196..217 | 5/20 (25%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 385..414 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 615..694 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||