DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and LRFN5

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001333102.1 Gene:LRFN5 / 145581 HGNCID:20360 Length:719 Species:Homo sapiens


Alignment Length:259 Identity:61/259 - (23%)
Similarity:104/259 - (40%) Gaps:66/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 LELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLL 285
            :||:|:.|.:::|..:.|..:..|..|.||:|.:..:.|:.|..::|    |:.|.|:.||:..:
Human    54 VELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRN----LRALHLNSNRLTKI 114

  Fly   286 FDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLS 350
            .::.|.                        ||.:|..|.|..|.:..|....|..:..|:.||||
Human   115 TNDMFS------------------------GLSNLHHLILNNNQLTLISSTAFDDVFALEELDLS 155

  Fly   351 YNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPM 415
            |||||          |:|..                |...:..|..|.|.||.:.::....|:.:
Human   156 YNNLE----------TIPWD----------------AVEKMVSLHTLSLDHNMIDNIPKGTFSHL 194

  Fly   416 RRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPC 479
            .::.:|.:..|.|:::..|.|...:.|            ||...:..|:...::..|||..|.|
Human   195 HKMTRLDVTSNKLQKLPPDPLFQRAQV------------LATSGIISPSTFALSFGGNPLHCNC 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 11/34 (32%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 53/233 (23%)
LRR_8 194..254 CDD:290566 11/32 (34%)
leucine-rich repeat 196..219 CDD:275380
leucine-rich repeat 220..243 CDD:275380 6/21 (29%)
leucine-rich repeat 244..267 CDD:275380 7/22 (32%)
LRR_8 271..330 CDD:290566 12/58 (21%)
leucine-rich repeat 272..295 CDD:275380 6/22 (27%)
leucine-rich repeat 296..319 CDD:275380 2/22 (9%)
LRR_8 319..380 CDD:290566 18/60 (30%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 11/24 (46%)
LRR_8 368..428 CDD:290566 10/59 (17%)
leucine-rich repeat 370..393 CDD:275380 1/22 (5%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..441 CDD:275380 5/22 (23%)
LRFN5NP_001333102.1 LRR 1 52..73 6/18 (33%)
LRR 2 76..97 7/20 (35%)
LRR 3 100..121 7/48 (15%)
LRR 4 124..145 6/20 (30%)
LRR 5 148..169 13/46 (28%)
LRR 6 172..193 6/20 (30%)
LRR 7 196..217 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..414
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 615..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.