DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and LRRC15

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001128529.2 Gene:LRRC15 / 131578 HGNCID:20818 Length:587 Species:Homo sapiens


Alignment Length:463 Identity:133/463 - (28%)
Similarity:205/463 - (44%) Gaps:61/463 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LDLTGAAPINVHTNGFSILP-NLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFF 148
            ::.|||..:.|.|.    || |...|.:....:.::..:.|...|||..:....|::..:....|
Human    43 VECTGARIVAVPTP----LPWNAMSLQILNTHITELNESPFLNISALIALRIEKNELSRITPGAF 103

  Fly   149 GNLRKLIYANFSHNALKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNA 213
            .||..|.|.:.::|.|:.     :|:             ..|.....|:.|:|:.|||:|:....
Human   104 RNLGSLRYLSLANNKLQV-----LPI-------------GLFQGLDSLESLLLSSNQLLQIQPAH 150

  Fly   214 FRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLS 278
            |.....|.||||.||.|..|....|..|..|.||||.:|:|..:.|.||..:.|    ||.|.|.
Human   151 FSQCSNLKELQLHGNHLEYIPDGAFDHLVGLTKLNLGKNSLTHISPRVFQHLGN----LQVLRLY 211

  Fly   279 GNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLN 343
            .||:..:....|..|..||.|.:.:|.|..|||..|....:|::|||..|.|.::.|:.|..|..
Human   212 ENRLTDIPMGTFDGLVNLQELALQQNQIGLLSPGLFHNNHNLQRLYLSNNHISQLPPSVFMQLPQ 276

  Fly   344 LDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLD 408
            |:.|.|..|:|:.|...|||  .:|.:|.|.|..|.:..|....||:|..|:.|.|..|::..:.
Human   277 LNRLTLFGNSLKELSPGIFG--PMPNLRELWLYDNHISSLPDNVFSNLRQLQVLILSRNQISFIS 339

  Fly   409 VRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRL-----TFLAKVN----VSFPN 464
            ...|..:..|::|.|..|.|::::.:|...|:::|.|.:.||||     ...|.||    :...|
Human   340 PGAFNGLTELRELSLHTNALQDLDGNVFRMLANLQNISLQNNRLRQLPGNIFANVNGLMAIQLQN 404

  Fly   465 ----------------LKRVAIEGNPWQCPC-FVKLQHWLATR------DVVYLRDNTGYYKGER 506
                            |..:.:..|||:|.. .:.|::||...      |.|.:..:....:|:.
Human   405 NQLENLPLGIFDHLGKLCELRLYDNPWRCDSDILPLRNWLLLNQPRLGTDTVPVCFSPANVRGQS 469

  Fly   507 PLCIVTNV 514
            .:.|..||
Human   470 LIIINVNV 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 44/153 (29%)
LRR_8 104..164 CDD:290566 14/60 (23%)
leucine-rich repeat 106..129 CDD:275380 2/22 (9%)
leucine-rich repeat 130..153 CDD:275380 5/22 (23%)
leucine-rich repeat 154..195 CDD:275380 6/40 (15%)
LRR_RI 194..455 CDD:238064 92/265 (35%)
LRR_8 194..254 CDD:290566 25/59 (42%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
leucine-rich repeat 220..243 CDD:275380 11/22 (50%)
leucine-rich repeat 244..267 CDD:275380 10/22 (45%)
LRR_8 271..330 CDD:290566 22/58 (38%)
leucine-rich repeat 272..295 CDD:275380 8/22 (36%)
leucine-rich repeat 296..319 CDD:275380 9/22 (41%)
LRR_8 319..380 CDD:290566 23/60 (38%)
leucine-rich repeat 320..343 CDD:275380 9/22 (41%)
leucine-rich repeat 344..369 CDD:275380 9/24 (38%)
LRR_8 368..428 CDD:290566 18/59 (31%)
leucine-rich repeat 370..393 CDD:275380 8/22 (36%)
leucine-rich repeat 394..417 CDD:275380 5/22 (23%)
leucine-rich repeat 418..441 CDD:275380 7/22 (32%)
LRRC15NP_001128529.2 LRR_8 60..119 CDD:290566 13/58 (22%)
LRR_RI 63..309 CDD:238064 84/269 (31%)
LRR_8 88..167 CDD:290566 25/96 (26%)
leucine-rich repeat 88..108 CDD:275380 4/19 (21%)
leucine-rich repeat 109..156 CDD:275380 14/64 (22%)
leucine-rich repeat 157..180 CDD:275380 11/22 (50%)
LRR_8 180..239 CDD:290566 23/62 (37%)
leucine-rich repeat 181..204 CDD:275380 10/22 (45%)
leucine-rich repeat 205..228 CDD:275380 8/22 (36%)
LRR_8 228..287 CDD:290566 22/58 (38%)
leucine-rich repeat 229..252 CDD:275380 9/22 (41%)
leucine-rich repeat 253..276 CDD:275380 9/22 (41%)
leucine-rich repeat 277..300 CDD:275380 9/24 (38%)
LRR_8 299..359 CDD:290566 18/59 (31%)
LRR_4 299..340 CDD:289563 13/40 (33%)
leucine-rich repeat 301..324 CDD:275380 8/22 (36%)
LRR_4 324..364 CDD:289563 10/39 (26%)
leucine-rich repeat 325..348 CDD:275380 5/22 (23%)
leucine-rich repeat 349..370 CDD:275380 6/20 (30%)
LRR_8 372..430 CDD:290566 11/57 (19%)
leucine-rich repeat 373..393 CDD:275380 6/19 (32%)
leucine-rich repeat 397..418 CDD:275380 1/20 (5%)
TPKR_C2 429..>468 CDD:301599 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.