| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_319043.4 | Gene: | AgaP_AGAP009924 / 1279336 | VectorBaseID: | AGAP009924 | Length: | 557 | Species: | Anopheles gambiae |
| Alignment Length: | 213 | Identity: | 65/213 - (30%) |
|---|---|---|---|
| Similarity: | 99/213 - (46%) | Gaps: | 33/213 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 272 LQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPA 336
Fly 337 TFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGN----------------------- 378
Fly 379 -RMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHN----LLEEINLDVLES 438
Fly 439 LSSVQEILVDNNRLTFLA 456 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 64/210 (30%) | ||
| LRR_8 | 194..254 | CDD:290566 | |||
| leucine-rich repeat | 196..219 | CDD:275380 | |||
| leucine-rich repeat | 220..243 | CDD:275380 | |||
| leucine-rich repeat | 244..267 | CDD:275380 | |||
| LRR_8 | 271..330 | CDD:290566 | 17/57 (30%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 319..380 | CDD:290566 | 28/84 (33%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 14/24 (58%) | ||
| LRR_8 | 368..428 | CDD:290566 | 23/87 (26%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 9/46 (20%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 6/26 (23%) | ||
| AgaP_AGAP009924 | XP_319043.4 | LRR_RI | 33..>186 | CDD:238064 | 52/154 (34%) |
| leucine-rich repeat | 34..57 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 57..116 | CDD:290566 | 28/60 (47%) | ||
| LRR_4 | 57..97 | CDD:289563 | 20/39 (51%) | ||
| leucine-rich repeat | 58..81 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 82..105 | CDD:275380 | 14/24 (58%) | ||
| leucine-rich repeat | 106..129 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 130..153 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 133..187 | CDD:290566 | 17/53 (32%) | ||
| leucine-rich repeat | 154..177 | CDD:275380 | 8/22 (36%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||