DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AgaP_AGAP009688

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_318747.4 Gene:AgaP_AGAP009688 / 1279077 VectorBaseID:AGAP009688 Length:785 Species:Anopheles gambiae


Alignment Length:385 Identity:104/385 - (27%)
Similarity:170/385 - (44%) Gaps:54/385 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNALKQCDLPHMPLLNRLE---LGHNRLVNATFG 191
            |.::..|:|.:|.:|.:....|..|.:.:.|.||:::......|:.|.|:   |..|:||..|.|
Mosquito    18 LTKLIASNNLIETIDAEALAGLPALKFLDLSRNAIQEVQYSSFPVKNNLQYLNLNFNKLVVLTKG 82

  Fly   192 VCPQLQELILNDNQLIQLDVNA-------FRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNL 249
            ...:||.|     :.::..|||       ...|..||.|::|.|.|..:...|||.|.||:.|. 
Mosquito    83 TFNRLQSL-----KRLKCCVNARYNNAYILFTLLCLLFLEISSNGLEEVQSLTFQNLNQLKNLK- 141

  Fly   250 SQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHF 314
                                       |:.|||..|.|..|..|..:..|:::.|||:::....|
Mosquito   142 ---------------------------LNNNRIPALLDGVFHGLIAIGTLELNNNSISTIHKGGF 179

  Fly   315 VGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNR 379
            ..|.||..|.|.:|.|.||:.:.:.....|.:||||||.||.|:...|  ..|..::.|||.|||
Mosquito   180 FNLTSLTNLGLAHNRIEEIEQSGWEFTPKLISLDLSYNQLESLDRSTF--EELSDLQTLNLQGNR 242

  Fly   380 MKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAP---MRRLQKLHLGHNLLEEINLDVLESLSS 441
            :..:....|:....|:.|.|..|.:......|..|   :.:|::|:|..|.::.::.:....|.|
Mosquito   243 IAEIGEGTFNETTSLKTLYLSGNRISETIEDMSGPFTGLGKLERLYLNANQIKSVSRNAFLGLKS 307

  Fly   442 VQEILVDNNRLTFLAKVNVSF---PNLKRVAIEGNPWQCPCFVK-LQHWLATRDVVYLRD 497
            :..:.:..|.::.:.  :.||   |.||.:.:......|.|.:: ...|:..|..|:..|
Mosquito   308 LTLLELSQNNISSIQ--SNSFRDTPQLKNLIMNSTNLICDCNLRWFYRWIRDRSNVFQID 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 39/135 (29%)
LRR_8 104..164 CDD:290566 9/33 (27%)
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380 6/22 (27%)
leucine-rich repeat 154..195 CDD:275380 13/43 (30%)
LRR_RI 194..455 CDD:238064 74/270 (27%)
LRR_8 194..254 CDD:290566 20/66 (30%)
leucine-rich repeat 196..219 CDD:275380 7/29 (24%)
leucine-rich repeat 220..243 CDD:275380 10/22 (45%)
leucine-rich repeat 244..267 CDD:275380 2/22 (9%)
LRR_8 271..330 CDD:290566 19/58 (33%)
leucine-rich repeat 272..295 CDD:275380 8/22 (36%)
leucine-rich repeat 296..319 CDD:275380 6/22 (27%)
LRR_8 319..380 CDD:290566 25/60 (42%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 12/24 (50%)
LRR_8 368..428 CDD:290566 17/62 (27%)
leucine-rich repeat 370..393 CDD:275380 7/22 (32%)
leucine-rich repeat 394..417 CDD:275380 6/25 (24%)
leucine-rich repeat 418..441 CDD:275380 5/22 (23%)
AgaP_AGAP009688XP_318747.4 LRR_RI <1..219 CDD:238064 68/233 (29%)
LRR_8 16..76 CDD:290566 15/57 (26%)
leucine-rich repeat 18..41 CDD:275380 6/22 (27%)
leucine-rich repeat 42..65 CDD:275380 5/22 (23%)
LRR_8 65..147 CDD:290566 29/114 (25%)
leucine-rich repeat 66..89 CDD:275380 8/22 (36%)
leucine-rich repeat 90..136 CDD:275380 15/50 (30%)
LRR_8 136..195 CDD:290566 22/86 (26%)
leucine-rich repeat 137..160 CDD:275380 10/50 (20%)
LRR_RI 139..345 CDD:238064 60/237 (25%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
LRR_8 183..243 CDD:290566 25/61 (41%)
leucine-rich repeat 185..208 CDD:275380 7/22 (32%)
leucine-rich repeat 209..232 CDD:275380 12/24 (50%)
leucine-rich repeat 233..256 CDD:275380 7/22 (32%)
LRR_8 255..318 CDD:290566 13/62 (21%)
leucine-rich repeat 257..283 CDD:275380 6/25 (24%)
leucine-rich repeat 284..307 CDD:275380 5/22 (23%)
leucine-rich repeat 308..328 CDD:275380 3/21 (14%)
LRRCT 342..389 CDD:214507 6/24 (25%)
I-set 395..492 CDD:254352
Ig 412..483 CDD:143165
I-set 496..586 CDD:254352
Ig 513..587 CDD:299845
I-set 594..677 CDD:254352
Ig 596..677 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.