DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and LOC1278834

DIOPT Version :10

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_318473.6 Gene:LOC1278834 / 1278834 VectorBaseID:AGAMI1_006358 Length:354 Species:Anopheles gambiae


Alignment Length:224 Identity:62/224 - (27%)
Similarity:107/224 - (47%) Gaps:43/224 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 KLNLSQN--ALDAL------RPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVS 302
            |:.|..|  |.||:      ||... .::|.::....|.|.                 |:..|.|
Mosquito    80 KILLRDNIVAYDAVLHEILKRPRAV-QIENVIIKTVDLPLD-----------------LEYADFS 126

  Fly   303 RNSIASLSPAHFVGLG-SLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNT 366
            .|.||::|.....|.. :||.|.||||.:..|.  :...|::|:||.|::|.:..::..:..|  
Mosquito   127 SNLIATVSAPEVNGSEYALRYLDLQYNRLTAID--SLRTLVHLETLLLAHNRIVVVDGSVLKG-- 187

  Fly   367 LPRMRRLNLNGNRMKHLHPLAFSSLP-FLEYLKLGHNELKSL--DVRMFAPMRRLQKLHLGHNLL 428
            .|::..|:|..|:   |....::.|| .||:|.|..|:..::  ...|:||..:|  |:|..|.|
Mosquito   188 FPKLSGLHLGANQ---LEEFPYADLPATLEWLVLCRNDFANVLEFTGMYAPALKL--LNLQDNFL 247

  Fly   429 EEINLD-VLESLSSVQEILVDNNRLTFLA 456
            ..:|:| :|.:..:::|:|:.|:   |:|
Mosquito   248 NSLNIDSLLAAAPNLKELLLRND---FIA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_8 104..164 CDD:404697
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
leucine-rich repeat 196..219 CDD:275380
LRR 199..>452 CDD:443914 60/218 (28%)
leucine-rich repeat 220..243 CDD:275380
leucine-rich repeat 244..267 CDD:275380 8/28 (29%)
leucine-rich repeat 272..295 CDD:275380 2/22 (9%)
leucine-rich repeat 296..319 CDD:275380 8/23 (35%)
leucine-rich repeat 320..343 CDD:275380 9/22 (41%)
leucine-rich repeat 344..369 CDD:275380 6/24 (25%)
leucine-rich repeat 370..393 CDD:275380 6/23 (26%)
leucine-rich repeat 394..417 CDD:275380 8/24 (33%)
leucine-rich repeat 418..441 CDD:275380 8/23 (35%)
LOC1278834XP_318473.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.