| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_318473.5 | Gene: | AgaP_AGAP004016 / 1278834 | VectorBaseID: | AGAP004016 | Length: | 354 | Species: | Anopheles gambiae |
| Alignment Length: | 224 | Identity: | 61/224 - (27%) |
|---|---|---|---|
| Similarity: | 106/224 - (47%) | Gaps: | 43/224 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 246 KLNLSQN--ALDAL------RPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVS 302
Fly 303 RNSIASLSPAHFVGLG-SLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNT 366
Fly 367 LPRMRRLNLNGNRMKHLHPLAFSSLP-FLEYLKLGHNELKSL--DVRMFAPMRRLQKLHLGHNLL 428
Fly 429 EEINLD-VLESLSSVQEILVDNNRLTFLA 456 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 4/11 (36%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 59/221 (27%) | ||
| LRR_8 | 194..254 | CDD:290566 | 3/9 (33%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | |||
| leucine-rich repeat | 220..243 | CDD:275380 | |||
| leucine-rich repeat | 244..267 | CDD:275380 | 8/28 (29%) | ||
| LRR_8 | 271..330 | CDD:290566 | 16/59 (27%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 2/22 (9%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 7/23 (30%) | ||
| LRR_8 | 319..380 | CDD:290566 | 19/60 (32%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 6/24 (25%) | ||
| LRR_8 | 368..428 | CDD:290566 | 19/62 (31%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 6/23 (26%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 8/24 (33%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 8/23 (35%) | ||
| AgaP_AGAP004016 | XP_318473.5 | leucine-rich repeat | 120..144 | CDD:275380 | 7/23 (30%) |
| LRR_RI | <141..>280 | CDD:238064 | 43/145 (30%) | ||
| LRR_8 | 145..201 | CDD:290566 | 19/62 (31%) | ||
| LRR_4 | 145..>177 | CDD:289563 | 14/33 (42%) | ||
| leucine-rich repeat | 145..166 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 167..190 | CDD:275380 | 6/24 (25%) | ||
| leucine-rich repeat | 191..211 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 213..236 | CDD:275380 | 8/24 (33%) | ||
| leucine-rich repeat | 237..261 | CDD:275380 | 8/23 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||