DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AgaP_AGAP003994

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_318447.2 Gene:AgaP_AGAP003994 / 1278814 VectorBaseID:AGAP003994 Length:370 Species:Anopheles gambiae


Alignment Length:320 Identity:83/320 - (25%)
Similarity:127/320 - (39%) Gaps:87/320 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 FQPLAQLRK--LNLSQNALDALRPNV------FGAVQNFVLHLQQLDLSGNRIRLLFDNQ----- 289
            ||...||..  :::..:...::.|.|      :|::.||. |             .|:||     
Mosquito    42 FQSWCQLHNATVHMDTDVQASVFPRVRQLGFIYGSIGNFT-H-------------TFNNQLFKAG 92

  Fly   290 -FRVLAR------------LQMLDVSRNSI--ASLSP-AHFVGLGSLRKLYLQYNAILEIKPATF 338
             .||.||            ::.|.:..|.:  ..:.| |.::    :|.|.||.|.:..|  |.|
Mosquito    93 VLRVFARGTRVTTLTMPSTIEQLYLRDNGLRTVEIDPRARYI----VRYLRLQMNKLRSI--AHF 151

  Fly   339 AALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHL--HPLAFSSLPFLEYLKLGH 401
            ..|..|..|:|..|.:|.:....|.  |:|.:|:|.|.||.:|.|  .|... .||.|.:|.||.
Mosquito   152 EHLTQLHELNLCDNLIEGVPLDTFA--TMPALRQLILCGNHIKTLGTTPTVI-QLPALTHLDLGG 213

  Fly   402 NELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLK 466
            |.|.||      |:.|.|       |.:.|||.|.::|.:.    :|:..|.      ..||.|:
Mosquito   214 NFLASL------PLERWQ-------LPQLINLSVRDNLLTT----LDSGLLV------RRFPLLR 255

  Fly   467 RVAIEGNPWQCPCFVKLQHWLATRDVVYLRDNTGYYKGERPLCIVTNVDYCIQNLQAVRR 526
            .:....|...|..:.:.......|.||:|.|        |.:|.|.  |..:.:.:.:||
Mosquito   256 ILDASANALDCHSYHQALQTFVNRSVVHLID--------RRMCSVD--DAIVLDAEEMRR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 4/19 (21%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 67/247 (27%)
LRR_8 194..254 CDD:290566 4/17 (24%)
leucine-rich repeat 196..219 CDD:275380
leucine-rich repeat 220..243 CDD:275380 2/4 (50%)
leucine-rich repeat 244..267 CDD:275380 4/30 (13%)
LRR_8 271..330 CDD:290566 17/79 (22%)
leucine-rich repeat 272..295 CDD:275380 5/28 (18%)
leucine-rich repeat 296..319 CDD:275380 4/25 (16%)
LRR_8 319..380 CDD:290566 22/60 (37%)
leucine-rich repeat 320..343 CDD:275380 9/22 (41%)
leucine-rich repeat 344..369 CDD:275380 7/24 (29%)
LRR_8 368..428 CDD:290566 22/61 (36%)
leucine-rich repeat 370..393 CDD:275380 9/24 (38%)
leucine-rich repeat 394..417 CDD:275380 9/22 (41%)
leucine-rich repeat 418..441 CDD:275380 7/22 (32%)
AgaP_AGAP003994XP_318447.2 LRR_RI <106..264 CDD:238064 54/189 (29%)
leucine-rich repeat 113..129 CDD:275380 2/15 (13%)
leucine-rich repeat 135..156 CDD:275378 9/22 (41%)
LRR_4 136..168 CDD:289563 13/33 (39%)
LRR_8 155..214 CDD:290566 22/61 (36%)
leucine-rich repeat 157..180 CDD:275378 7/24 (29%)
LRR_4 179..220 CDD:289563 19/47 (40%)
leucine-rich repeat 181..205 CDD:275378 9/24 (38%)
LRR_8 204..264 CDD:290566 24/82 (29%)
leucine-rich repeat 206..228 CDD:275378 12/34 (35%)
leucine-rich repeat 229..242 CDD:275378 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.