DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AgaP_AGAP011371

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_317948.4 Gene:AgaP_AGAP011371 / 1278325 VectorBaseID:AGAP011371 Length:320 Species:Anopheles gambiae


Alignment Length:317 Identity:87/317 - (27%)
Similarity:150/317 - (47%) Gaps:39/317 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 RLELGHNRL--VNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQ 239
            ||.:..||:  ::::.....:|..|.|:.|.|:.:....|.....||:|.|:.|:|.::...||.
Mosquito     1 RLVIKFNRIKSIDSSIQFYTELTMLDLSYNHLLSIPERIFMYQKKLLQLHLNNNKLGAVTNRTFG 65

  Fly   240 PLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLA--RLQMLDVS 302
            .|.:||.|||..|.:|.:...:|.|:..    |::|:|..|||..|..:.|..||  ||:.||:.
Mosquito    66 GLDELRVLNLRGNFIDEIGSELFKALPK----LEELNLGQNRIATLHASAFDGLANLRLRRLDIH 126

  Fly   303 RNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTL 367
            .:.:.:::...|.||.::|.|.|..|.:|::.....:.|..|:.|.:..|:.|.:.|..|.|  |
Mosquito   127 GSMLVNITSDTFRGLENIRSLDLSDNHLLKVPTVQLSGLKRLEELTIGQNDFETIPEGAFFG--L 189

  Fly   368 PRMRRLNLNGN-RMKHLHPLAFSSLPFLEYLKLGHN-ELKSLDVRMFAPMRRLQKLHLGHNLLEE 430
            ..::.::::|. .::.:...|||:.|.||.:.:..| ||..||...||.:..::|:.|.      
Mosquito   190 SNLKSIDISGALNLRQVQSGAFSANPNLESITIASNKELLELDEGAFAGLPHIRKVSLR------ 248

  Fly   431 INLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPCFVKLQHWL 487
                             ||...||..:: :.:.:|....:..||..|.|.|.   ||
Mosquito   249 -----------------DNKIATFHEEL-LPWKHLAEFDLTENPLVCDCNVL---WL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 25/80 (31%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380 4/19 (21%)
LRR_RI 194..455 CDD:238064 74/264 (28%)
LRR_8 194..254 CDD:290566 21/59 (36%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
leucine-rich repeat 220..243 CDD:275380 9/22 (41%)
leucine-rich repeat 244..267 CDD:275380 9/22 (41%)
LRR_8 271..330 CDD:290566 21/60 (35%)
leucine-rich repeat 272..295 CDD:275380 10/24 (42%)
leucine-rich repeat 296..319 CDD:275380 6/22 (27%)
LRR_8 319..380 CDD:290566 15/61 (25%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 8/24 (33%)
LRR_8 368..428 CDD:290566 16/61 (26%)
leucine-rich repeat 370..393 CDD:275380 4/23 (17%)
leucine-rich repeat 394..417 CDD:275380 9/23 (39%)
leucine-rich repeat 418..441 CDD:275380 2/22 (9%)
AgaP_AGAP011371XP_317948.4 leucine-rich repeat 1..21 CDD:275380 4/19 (21%)
LRR_8 20..78 CDD:290566 20/57 (35%)
LRR_RI <22..156 CDD:238064 45/137 (33%)
leucine-rich repeat 22..45 CDD:275380 6/22 (27%)
leucine-rich repeat 46..69 CDD:275380 9/22 (41%)
LRR_8 69..130 CDD:290566 23/64 (36%)
leucine-rich repeat 70..93 CDD:275380 9/22 (41%)
leucine-rich repeat 94..117 CDD:275380 9/22 (41%)
leucine-rich repeat 120..143 CDD:275380 6/22 (27%)
LRR_8 143..199 CDD:290566 14/57 (25%)
leucine-rich repeat 144..167 CDD:275380 6/22 (27%)
LRR_5 168..>250 CDD:290045 24/106 (23%)
leucine-rich repeat 168..191 CDD:275380 8/24 (33%)
leucine-rich repeat 192..216 CDD:275380 4/23 (17%)
leucine-rich repeat 217..241 CDD:275380 9/23 (39%)
leucine-rich repeat 242..260 CDD:275380 6/41 (15%)
LRRCT 273..320 CDD:214507 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.