DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AgaP_AGAP006348

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_316370.4 Gene:AgaP_AGAP006348 / 1276956 VectorBaseID:AGAP006348 Length:509 Species:Anopheles gambiae


Alignment Length:387 Identity:94/387 - (24%)
Similarity:144/387 - (37%) Gaps:99/387 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNA------LDALRP 259
            :.|:.|.|...:..:....:.||.||||.||.|......|..:|..||||.|.      |::|..
Mosquito    39 VTDSSLKQALASLRQSAWNVKELDLSGNPLSQISAADLAPFTKLELLNLSSNVLYETLDLESLST 103

  Fly   260 NVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLY 324
                        |:.|||:.|.::.|.     |...::.|..:.|:|:.:|.:.  |.|. :.:|
Mosquito   104 ------------LRTLDLNNNYVQELL-----VGPSIETLHAANNNISRVSCSR--GQGK-KNIY 148

  Fly   325 LQYNAILEIKPATFAALLNLDTLDLSYNNLE---FLEEQIFGGNTLPRMRRLNLNGNRMKHLHPL 386
            |..|.|..::.........:..|||..|.::   |.|                           |
Mosquito   149 LANNKITMLRDLDEGCRSRVQYLDLKLNEIDTVNFAE---------------------------L 186

  Fly   387 AFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNR 451
            |.|| ..||:|.|.:|.:  .||:......:|:.|.|..|.|..:..: .:|.:.|..|.:.||:
Mosquito   187 AASS-DTLEHLNLQYNFI--YDVKGQVVFAKLKTLDLSSNKLAFMGPE-FQSAAGVTWISLRNNK 247

  Fly   452 LTFLAKVNVSFPNLKRVAIEGNPWQC----PCFVKLQ--HWLATRDVVYLRDNTGYYKGERPLCI 510
            |..:.|......||:...:.||.:.|    ..|.|.|  ..:|.:.|..|   ||..:.|   |.
Mosquito   248 LVLIEKALRFSQNLEHFDLRGNGFHCGTLRDFFSKNQRVQTVAKQTVKKL---TGQNEEE---CT 306

  Fly   511 VTNVD----YCIQNLQA-----------------------VRRLGILGDFQGEQVEADAFDD 545
            |..:.    ||.::|.|                       ..||....:.|..|.|.||..:
Mosquito   307 VPTLGHYGAYCCEDLPAPFADRLIALKRKEHALLSGQGSETERLECERENQARQREIDALKE 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 20/60 (33%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 66/262 (25%)
LRR_8 194..254 CDD:290566 19/58 (33%)
leucine-rich repeat 196..219 CDD:275380 3/17 (18%)
leucine-rich repeat 220..243 CDD:275380 10/22 (45%)
leucine-rich repeat 244..267 CDD:275380 8/28 (29%)
LRR_8 271..330 CDD:290566 16/58 (28%)
leucine-rich repeat 272..295 CDD:275380 7/22 (32%)
leucine-rich repeat 296..319 CDD:275380 5/22 (23%)
LRR_8 319..380 CDD:290566 10/63 (16%)
leucine-rich repeat 320..343 CDD:275380 4/22 (18%)
leucine-rich repeat 344..369 CDD:275380 6/27 (22%)
LRR_8 368..428 CDD:290566 15/59 (25%)
leucine-rich repeat 370..393 CDD:275380 4/22 (18%)
leucine-rich repeat 394..417 CDD:275380 7/22 (32%)
leucine-rich repeat 418..441 CDD:275380 6/22 (27%)
AgaP_AGAP006348XP_316370.4 LRR_RI 33..271 CDD:238064 71/282 (25%)
LRR_8 57..112 CDD:290566 22/66 (33%)
leucine-rich repeat 58..81 CDD:275380 10/22 (45%)
leucine-rich repeat 82..103 CDD:275380 8/20 (40%)
leucine-rich repeat 123..146 CDD:275380 6/25 (24%)
LRR_8 145..201 CDD:290566 18/83 (22%)
leucine-rich repeat 168..192 CDD:275380 10/51 (20%)
leucine-rich repeat 193..214 CDD:275380 7/22 (32%)
LRR_8 214..271 CDD:290566 16/57 (28%)
leucine-rich repeat 215..237 CDD:275380 6/22 (27%)
leucine-rich repeat 238..260 CDD:275380 6/21 (29%)
Phasin 365..443 CDD:298582 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.