DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AgaP_AGAP005693

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_315704.4 Gene:AgaP_AGAP005693 / 1276366 VectorBaseID:AGAP005693 Length:437 Species:Anopheles gambiae


Alignment Length:399 Identity:104/399 - (26%)
Similarity:174/399 - (43%) Gaps:73/399 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LTGAAPINVHTNGFSILPNLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQM-ELLDRDFFGN 150
            |||..|..     |...|.|..||.:|..:..|:..:||....||.:....|:: :|.|..|||.
Mosquito    69 LTGIPPAM-----FQTFPKLESLNATGSDIKQIQSRNFADAKTLQSLYLRGNKIHDLPDVAFFGA 128

  Fly   151 LRKLIYANFSHNALKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFR 215
            .|                                           ||.|.|:||.:..::..||:
Mosquito   129 SR-------------------------------------------LQTLDLSDNAIATIESTAFK 150

  Fly   216 GLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGN 280
            .|..|..|.|..|.|:.:....|..|:.|.:|.|.||.|.::...:|....:    |..|::|.|
Mosquito   151 RLRELKTLLLGSNSLTELQPGVFDDLSDLERLELQQNGLGSIDDRLFQGCHS----LTALNVSHN 211

  Fly   281 RIRLLFDNQFRVLARLQMLDVSRN--SIASLSPAHFVGLGSLRKLYLQYNAILEIK-PATFAALL 342
            .::.....||.......::|.|.|  |:..:.|       :||:|....|.|..:: .||..:.|
Mosquito   212 ALKTFNVAQFERRWSFDLIDASYNKLSVVRIPP-------NLRQLVAIGNGIRTVESTATNGSEL 269

  Fly   343 NLDTLDLSYNNLEFLEE-QIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKS 406
            .|  |.|.:|.|..::| .:|     .::..|:|:.||::.....:.:....|..|||..|:|:|
Mosquito   270 IL--LKLPHNKLTSVDEVPVF-----DKLITLDLSFNRIREFDFRSAARFGKLVLLKLDGNQLES 327

  Fly   407 LDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNV--SFPNLKRVA 469
            :...:.||:..|:.:||..|....::|:||.::..:.::.:..|:|..||..::  |||.:.|:.
Mosquito   328 VSNSLTAPITHLKYVHLADNQFTHLDLNVLRTVPRILKLDLRRNQLERLAVTDLAGSFPVMVRIM 392

  Fly   470 IEGNPWQCP 478
            :|||.::||
Mosquito   393 LEGNRFRCP 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 39/153 (25%)
LRR_8 104..164 CDD:290566 17/60 (28%)
leucine-rich repeat 106..129 CDD:275380 7/22 (32%)
leucine-rich repeat 130..153 CDD:275380 8/23 (35%)
leucine-rich repeat 154..195 CDD:275380 0/40 (0%)
LRR_RI 194..455 CDD:238064 71/264 (27%)
LRR_8 194..254 CDD:290566 21/59 (36%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
leucine-rich repeat 220..243 CDD:275380 7/22 (32%)
leucine-rich repeat 244..267 CDD:275380 7/22 (32%)
LRR_8 271..330 CDD:290566 15/60 (25%)
leucine-rich repeat 272..295 CDD:275380 6/22 (27%)
leucine-rich repeat 296..319 CDD:275380 5/24 (21%)
LRR_8 319..380 CDD:290566 18/62 (29%)
leucine-rich repeat 320..343 CDD:275380 7/23 (30%)
leucine-rich repeat 344..369 CDD:275380 7/25 (28%)
LRR_8 368..428 CDD:290566 17/59 (29%)
leucine-rich repeat 370..393 CDD:275380 4/22 (18%)
leucine-rich repeat 394..417 CDD:275380 9/22 (41%)
leucine-rich repeat 418..441 CDD:275380 7/22 (32%)
AgaP_AGAP005693XP_315704.4 LRR_8 57..117 CDD:290566 16/52 (31%)
leucine-rich repeat 59..82 CDD:275380 5/17 (29%)
leucine-rich repeat 83..106 CDD:275380 7/22 (32%)
LRR_8 105..165 CDD:290566 22/102 (22%)
LRR_4 105..146 CDD:289563 15/83 (18%)
leucine-rich repeat 107..130 CDD:275380 8/22 (36%)
LRR_RI 131..398 CDD:238064 80/284 (28%)
leucine-rich repeat 131..154 CDD:275380 9/22 (41%)
LRR_8 153..213 CDD:290566 18/63 (29%)
leucine-rich repeat 155..178 CDD:275380 7/22 (32%)
leucine-rich repeat 179..202 CDD:275380 7/22 (32%)
leucine-rich repeat 203..226 CDD:275380 6/22 (27%)
leucine-rich repeat 227..268 CDD:275380 12/47 (26%)
leucine-rich repeat 269..290 CDD:275380 8/27 (30%)
LRR_8 272..325 CDD:290566 15/57 (26%)
leucine-rich repeat 291..314 CDD:275380 4/22 (18%)
leucine-rich repeat 315..338 CDD:275380 9/22 (41%)
leucine-rich repeat 339..358 CDD:275380 6/18 (33%)
leucine-rich repeat 363..383 CDD:275380 4/19 (21%)
leucine-rich repeat 388..400 CDD:275378 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.