DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AgaP_AGAP005496

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_315493.3 Gene:AgaP_AGAP005496 / 1276179 VectorBaseID:AGAP005496 Length:485 Species:Anopheles gambiae


Alignment Length:315 Identity:75/315 - (23%)
Similarity:142/315 - (45%) Gaps:56/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 FRGLHGLLELQLSGNRLSSIGLETFQP---LAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQL 275
            |:|:|  :|   |..:.:::.||  .|   .|.:.::....:::.||..:::||.:    .||:|
Mosquito    39 FQGVH--IE---SSEQAANVQLE--PPAGAAADVTRVKFRDSSMVALPSSLYGAFR----QLQEL 92

  Fly   276 DLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLS--PAHFVGLGSLRKLYLQYNAILEIKPATF 338
                 |:..:..:...:..||..||..:|.|:|::  |.   .:..||||.|..|.:..|.  ..
Mosquito    93 -----RVWWMHLHSIHIDPRLLSLDAEKNRISSITTEPG---TVPLLRKLELNQNRLRNID--NI 147

  Fly   339 AALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNE 403
            :...||:.|:|::|:|..|:..:|  ..:|::|.|:|:.|.:    .|..||        :|..:
Mosquito   148 SVFENLEVLELAHNDLRTLDLCVF--QRMPKLRLLDLSSNNL----ALVRSS--------IGAEK 198

  Fly   404 LKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFL--AKVNVSFPNLK 466
            |.||.|           |:|..|.|..::|.:|.|..:::::.:.||.|.::  ..:....|.|:
Mosquito   199 LASLTV-----------LYLNDNRLTYLDLSILRSFPALEKVHLANNALVYVDHDSLPTMLPRLR 252

  Fly   467 RVAIEGNPWQCPCFVKLQHWLATRDVVYLRDNTGYYKGER---PLCIVTNVDYCI 518
            ...::.|.|.|....:|...|....|...:..:.:...||   .:|...|..:.:
Mosquito   253 VFHLQTNDWHCEGLAELIGQLRKTGVQDFKTFSAFSCKERMVEGICCTENKPFAL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 9/44 (20%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 63/245 (26%)
LRR_8 194..254 CDD:290566 9/42 (21%)
leucine-rich repeat 196..219 CDD:275380 2/4 (50%)
leucine-rich repeat 220..243 CDD:275380 5/25 (20%)
leucine-rich repeat 244..267 CDD:275380 4/22 (18%)
LRR_8 271..330 CDD:290566 18/60 (30%)
leucine-rich repeat 272..295 CDD:275380 4/22 (18%)
leucine-rich repeat 296..319 CDD:275380 7/24 (29%)
LRR_8 319..380 CDD:290566 20/60 (33%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 7/24 (29%)
LRR_8 368..428 CDD:290566 16/59 (27%)
leucine-rich repeat 370..393 CDD:275380 7/22 (32%)
leucine-rich repeat 394..417 CDD:275380 5/22 (23%)
leucine-rich repeat 418..441 CDD:275380 7/22 (32%)
AgaP_AGAP005496XP_315493.3 leucine-rich repeat 108..123 CDD:275380 6/14 (43%)
LRR_RI <129..275 CDD:238064 45/172 (26%)
LRR_8 129..187 CDD:290566 20/61 (33%)
LRR_4 131..167 CDD:289563 13/37 (35%)
leucine-rich repeat 131..152 CDD:275380 7/22 (32%)
leucine-rich repeat 153..176 CDD:275380 7/24 (29%)
LRR_8 175..236 CDD:290566 22/83 (27%)
leucine-rich repeat 177..201 CDD:275380 9/35 (26%)
LRR_4 201..>236 CDD:289563 12/45 (27%)
leucine-rich repeat 202..225 CDD:275380 9/33 (27%)
leucine-rich repeat 226..250 CDD:275380 3/23 (13%)
Kinesin_assoc 329..>443 CDD:292801
MreC 401..>468 CDD:302802
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.