| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001243314.1 | Gene: | LRRC39 / 127495 | HGNCID: | 28228 | Length: | 339 | Species: | Homo sapiens |
| Alignment Length: | 236 | Identity: | 64/236 - (27%) |
|---|---|---|---|
| Similarity: | 98/236 - (41%) | Gaps: | 40/236 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 241 LAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNS 305
Fly 306 IASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRM 370
Fly 371 RRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINL-- 433
Fly 434 DVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNP 474 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 5/14 (36%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 59/215 (27%) | ||
| LRR_8 | 194..254 | CDD:290566 | 4/12 (33%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | |||
| leucine-rich repeat | 220..243 | CDD:275380 | 1/1 (100%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 271..330 | CDD:290566 | 21/58 (36%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 319..380 | CDD:290566 | 15/60 (25%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 6/24 (25%) | ||
| LRR_8 | 368..428 | CDD:290566 | 15/59 (25%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 5/24 (21%) | ||
| LRRC39 | NP_001243314.1 | LRR_RI | 79..>263 | CDD:238064 | 59/218 (27%) |
| LRR_8 | 84..141 | CDD:290566 | 21/62 (34%) | ||
| LRR 1 | 84..105 | 6/21 (29%) | |||
| leucine-rich repeat | 85..107 | CDD:275380 | 5/22 (23%) | ||
| LRR 2 | 107..128 | 7/25 (28%) | |||
| leucine-rich repeat | 108..127 | CDD:275380 | 6/23 (26%) | ||
| LRR_8 | 129..188 | CDD:290566 | 23/59 (39%) | ||
| LRR 3 | 130..151 | 8/21 (38%) | |||
| leucine-rich repeat | 131..153 | CDD:275380 | 7/22 (32%) | ||
| LRR 4 | 153..176 | 7/22 (32%) | |||
| leucine-rich repeat | 154..177 | CDD:275380 | 7/22 (32%) | ||
| LRR 5 | 177..197 | 9/46 (20%) | |||
| leucine-rich repeat | 178..200 | CDD:275380 | 9/48 (19%) | ||
| LRR 6 | 200..221 | 7/24 (29%) | |||
| leucine-rich repeat | 201..223 | CDD:275380 | 8/25 (32%) | ||
| LRR_8 | 223..280 | CDD:290566 | 12/57 (21%) | ||
| LRR 7 | 223..244 | 4/20 (20%) | |||
| leucine-rich repeat | 224..246 | CDD:275380 | 4/21 (19%) | ||
| LRR 8 | 246..267 | 3/20 (15%) | |||
| leucine-rich repeat | 247..269 | CDD:275380 | 3/21 (14%) | ||
| LRR 9 | 269..290 | 5/11 (45%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||