DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and AgaP_AGAP007471

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_308401.2 Gene:AgaP_AGAP007471 / 1269752 VectorBaseID:AGAP007471 Length:406 Species:Anopheles gambiae


Alignment Length:314 Identity:76/314 - (24%)
Similarity:138/314 - (43%) Gaps:55/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 DNQLIQLDVNAFRGLHGLL--ELQLSGNR-LSSIGLE---------TFQPLAQLRKLNLSQNALD 255
            ||.|.::::     ::|::  .|....|| |:.:.:|         |...:.:|..|.:.|.||.
Mosquito    65 DNTLTEIEI-----VNGVMLRSLVAGTNRHLTRLYVENCLLDRIPPTLSNMIELEGLLIKQCALT 124

  Fly   256 ALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQM--LDVSRNSIASLSPAHFVGLG 318
            |||.:|.  |.|  ..|..:||:.||||.||........:|.:  |.::.|.:..|..:.|..:.
Mosquito   125 ALRLDVL--VNN--PKLTAIDLTRNRIRQLFPITTPPKTKLPVTFLSLAENQLDRLDMSMFAFMP 185

  Fly   319 SLRKLYLQYNAILEIK---PATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRM 380
            .|.:..::.|.|:..:   |.|:.:|:.   |.:|.||:...:.:   ..||..:|.|.:|.|.:
Mosquito   186 DLERFNVEGNRIVRFEATAPVTYGSLIR---LLVSSNNITQFDTR---NLTLTELRSLYINDNAL 244

  Fly   381 KHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEI 445
            ..| |..:..||.|.|:....|.||.:|:..|.....|..:.:..|.:|.|......::..::.:
Mosquito   245 TEL-PTHWGKLPNLIYIGFDRNNLKRIDMSFFEKFPTLISITISENNVESIRTSTPITMPELEYL 308

  Fly   446 LVDNNRLTFLAKVNVSFPNL----------------------KRVAIEGNPWQC 477
            :.:.|::..:.....:|||:                      .|:|::|||.:|
Mosquito   309 MFNGNQIVSVNFTGCNFPNMYLFSFMNNRLTTIPPLFQRFPDSRLAMDGNPIKC 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 15/64 (23%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 67/268 (25%)
LRR_8 194..254 CDD:290566 13/62 (21%)
leucine-rich repeat 196..219 CDD:275380 3/15 (20%)
leucine-rich repeat 220..243 CDD:275380 6/34 (18%)
leucine-rich repeat 244..267 CDD:275380 10/22 (45%)
LRR_8 271..330 CDD:290566 16/60 (27%)
leucine-rich repeat 272..295 CDD:275380 9/22 (41%)
leucine-rich repeat 296..319 CDD:275380 5/24 (21%)
LRR_8 319..380 CDD:290566 16/63 (25%)
leucine-rich repeat 320..343 CDD:275380 6/25 (24%)
leucine-rich repeat 344..369 CDD:275380 6/24 (25%)
LRR_8 368..428 CDD:290566 17/59 (29%)
leucine-rich repeat 370..393 CDD:275380 7/22 (32%)
leucine-rich repeat 394..417 CDD:275380 7/22 (32%)
leucine-rich repeat 418..441 CDD:275380 4/22 (18%)
AgaP_AGAP007471XP_308401.2 LRR_8 88..147 CDD:290566 19/62 (31%)
leucine-rich repeat 90..112 CDD:275380 3/21 (14%)
leucine-rich repeat 113..136 CDD:275380 11/26 (42%)
LRR_8 135..197 CDD:290566 16/61 (26%)
leucine-rich repeat 137..160 CDD:275380 9/22 (41%)
leucine-rich repeat 161..186 CDD:275380 5/24 (21%)
leucine-rich repeat 187..210 CDD:275380 5/22 (23%)
leucine-rich repeat 211..233 CDD:275380 7/27 (26%)
LRR_8 232..291 CDD:290566 17/59 (29%)
leucine-rich repeat 234..256 CDD:275380 7/22 (32%)
leucine-rich repeat 257..280 CDD:275380 7/22 (32%)
leucine-rich repeat 281..304 CDD:275380 4/22 (18%)
leucine-rich repeat 305..327 CDD:275380 2/21 (10%)
leucine-rich repeat 328..350 CDD:275380 0/21 (0%)
leucine-rich repeat 351..370 CDD:275380 6/12 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.