| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_308401.2 | Gene: | AgaP_AGAP007471 / 1269752 | VectorBaseID: | AGAP007471 | Length: | 406 | Species: | Anopheles gambiae |
| Alignment Length: | 314 | Identity: | 76/314 - (24%) |
|---|---|---|---|
| Similarity: | 138/314 - (43%) | Gaps: | 55/314 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 203 DNQLIQLDVNAFRGLHGLL--ELQLSGNR-LSSIGLE---------TFQPLAQLRKLNLSQNALD 255
Fly 256 ALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQM--LDVSRNSIASLSPAHFVGLG 318
Fly 319 SLRKLYLQYNAILEIK---PATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRM 380
Fly 381 KHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEI 445
Fly 446 LVDNNRLTFLAKVNVSFPNL----------------------KRVAIEGNPWQC 477 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 15/64 (23%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 67/268 (25%) | ||
| LRR_8 | 194..254 | CDD:290566 | 13/62 (21%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 3/15 (20%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 6/34 (18%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 271..330 | CDD:290566 | 16/60 (27%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 5/24 (21%) | ||
| LRR_8 | 319..380 | CDD:290566 | 16/63 (25%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 6/25 (24%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 6/24 (25%) | ||
| LRR_8 | 368..428 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 4/22 (18%) | ||
| AgaP_AGAP007471 | XP_308401.2 | LRR_8 | 88..147 | CDD:290566 | 19/62 (31%) |
| leucine-rich repeat | 90..112 | CDD:275380 | 3/21 (14%) | ||
| leucine-rich repeat | 113..136 | CDD:275380 | 11/26 (42%) | ||
| LRR_8 | 135..197 | CDD:290566 | 16/61 (26%) | ||
| leucine-rich repeat | 137..160 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 161..186 | CDD:275380 | 5/24 (21%) | ||
| leucine-rich repeat | 187..210 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 211..233 | CDD:275380 | 7/27 (26%) | ||
| LRR_8 | 232..291 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 234..256 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 305..327 | CDD:275380 | 2/21 (10%) | ||
| leucine-rich repeat | 328..350 | CDD:275380 | 0/21 (0%) | ||
| leucine-rich repeat | 351..370 | CDD:275380 | 6/12 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||