DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and lrrc26

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_031746479.1 Gene:lrrc26 / 116406528 -ID:- Length:304 Species:Xenopus tropicalis


Alignment Length:197 Identity:60/197 - (30%)
Similarity:94/197 - (47%) Gaps:33/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 TLDLSYNNLEFLEEQIFGGNTLPRMRR---LNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSL 407
            |:.|.||::..:.     |..|.|.||   |:|..||:..:|..||.....|.||.|..|:|.::
 Frog    53 TVLLGYNHIGAIT-----GLCLQRYRRMEHLDLRSNRISTIHSRAFRYQQNLTYLDLSANQLATI 112

  Fly   408 DVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLA-KVNVSFPNLKRVAIE 471
            ...:|.|:..|..|.||:|.:.|:....|:|..::..:.:.||.||.|| .:..:..||:.:.::
 Frog   113 PAELFRPLANLLTLDLGNNRISELPGSALDSSLALDTLYLHNNALTGLAGPLLGNLGNLRHLRLD 177

  Fly   472 GNPWQCPCFVK-LQHWLATR-DVVYLRDNT--GY--YKGERPLCIVTNVDYCIQNLQAVRRLGIL 530
            ||||.|.|.:: |.:|:... :.:..||.|  |:  |..:.||                  |||.
 Frog   178 GNPWACTCQIQTLLNWIKQNPERLEERDRTLCGFPGYLDQYPL------------------LGIQ 224

  Fly   531 GD 532
            ||
 Frog   225 GD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 36/111 (32%)
LRR_8 194..254 CDD:290566
leucine-rich repeat 196..219 CDD:275380
leucine-rich repeat 220..243 CDD:275380
leucine-rich repeat 244..267 CDD:275380
LRR_8 271..330 CDD:290566
leucine-rich repeat 272..295 CDD:275380
leucine-rich repeat 296..319 CDD:275380
LRR_8 319..380 CDD:290566 12/36 (33%)
leucine-rich repeat 320..343 CDD:275380
leucine-rich repeat 344..369 CDD:275380 6/22 (27%)
LRR_8 368..428 CDD:290566 23/62 (37%)
leucine-rich repeat 370..393 CDD:275380 9/25 (36%)
leucine-rich repeat 394..417 CDD:275380 8/22 (36%)
leucine-rich repeat 418..441 CDD:275380 8/22 (36%)
lrrc26XP_031746479.1 LRR <51..>196 CDD:227223 48/147 (33%)
leucine-rich repeat 52..74 CDD:275380 7/25 (28%)
leucine-rich repeat 75..98 CDD:275380 7/22 (32%)
leucine-rich repeat 99..122 CDD:275380 8/22 (36%)
leucine-rich repeat 123..146 CDD:275380 8/22 (36%)
leucine-rich repeat 147..170 CDD:275380 6/22 (27%)
TPKR_C2 179..232 CDD:417692 19/66 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7602
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.