| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_821072.1 | Gene: | Lrrtm2 / 107065 | MGIID: | 2389174 | Length: | 515 | Species: | Mus musculus |
| Alignment Length: | 285 | Identity: | 91/285 - (31%) |
|---|---|---|---|
| Similarity: | 146/285 - (51%) | Gaps: | 16/285 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 215 RGLH--------GLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLH 271
Fly 272 LQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPA 336
Fly 337 TFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGH 401
Fly 402 NELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFL-AKVNVSFPNL 465
Fly 466 KRVAIEGNPWQC-PCFVKLQHWLAT 489 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 13/48 (27%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 78/247 (32%) | ||
| LRR_8 | 194..254 | CDD:290566 | 13/46 (28%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 2/11 (18%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 271..330 | CDD:290566 | 25/58 (43%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 12/22 (55%) | ||
| LRR_8 | 319..380 | CDD:290566 | 21/60 (35%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 11/24 (46%) | ||
| LRR_8 | 368..428 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 9/22 (41%) | ||
| Lrrtm2 | NP_821072.1 | LRR 1 | 63..83 | 5/19 (26%) | |
| LRR | <65..312 | CDD:227223 | 80/252 (32%) | ||
| leucine-rich repeat | 66..86 | CDD:275380 | 4/19 (21%) | ||
| LRR 2 | 86..107 | 6/20 (30%) | |||
| leucine-rich repeat | 87..110 | CDD:275380 | 5/22 (23%) | ||
| LRR 3 | 110..131 | 8/24 (33%) | |||
| leucine-rich repeat | 111..134 | CDD:275380 | 9/22 (41%) | ||
| LRR 4 | 134..155 | 10/20 (50%) | |||
| leucine-rich repeat | 135..158 | CDD:275380 | 12/22 (55%) | ||
| LRR 5 | 158..179 | 6/20 (30%) | |||
| leucine-rich repeat | 159..182 | CDD:275380 | 6/22 (27%) | ||
| LRR 6 | 182..203 | 9/20 (45%) | |||
| leucine-rich repeat | 183..206 | CDD:275380 | 11/24 (46%) | ||
| LRR 7 | 206..227 | 5/20 (25%) | |||
| leucine-rich repeat | 207..230 | CDD:275380 | 6/22 (27%) | ||
| LRR 8 | 230..251 | 6/20 (30%) | |||
| leucine-rich repeat | 231..254 | CDD:275380 | 6/22 (27%) | ||
| LRR 9 | 254..275 | 8/20 (40%) | |||
| leucine-rich repeat | 255..278 | CDD:275380 | 9/22 (41%) | ||
| LRR 10 | 278..299 | 7/20 (35%) | |||
| leucine-rich repeat | 279..300 | CDD:275380 | 7/20 (35%) | ||
| PCC | 284..>351 | CDD:188093 | 17/45 (38%) | ||
| Involved in DLG4-binding. /evidence=ECO:0000250 | 512..515 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||