DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and LOC101884430

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_021325136.1 Gene:LOC101884430 / 101884430 -ID:- Length:635 Species:Danio rerio


Alignment Length:453 Identity:132/453 - (29%)
Similarity:193/453 - (42%) Gaps:75/453 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 FSILPNLRQLNLSG-----CGLVDIRGN-----------HFAPESALQRIDFSHNQMELLDRDFF 148
            |::|..|.||.||.     | :.||||:           ...|......:....|...|.||. |
Zfish     5 FALLQLLPQLTLSSWCPSEC-VCDIRGSAKCIGNINDIPQLDPTKTFLLLLNDTNIKVLKDRS-F 67

  Fly   149 GNLRKLIYANFSHNALK--QCDLPH-MPLLNRLELGHNRLVNATFGVCP--------QLQELILN 202
            ..|..|:....:|:.|.  |.:..| .|.|..:::..|.|     .|.|        .|::|.|:
Zfish    68 QQLSLLLRVMITHSTLDTIQPEAFHGAPQLRSIKMSSNAL-----AVVPPKVFIEQRNLEQLQLD 127

  Fly   203 DNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQN 267
            .||::.:....|.||..:.||.||.||:|.:....||.|.:|..|||:.|.|..|...||..:.|
Zfish   128 GNQIVSVSSELFEGLVSMTELDLSKNRISQLDAGVFQSLTKLIYLNLAGNQLRNLPKTVFHNLGN 192

  Fly   268 FVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILE 332
                ||.|.|:.|.:.:|....|..|:.|.:|.:.:|.|..:.|..|..:.||..|.:..|.:..
Zfish   193 ----LQTLVLTSNHLEILESGSFDHLSNLLVLMLQKNQIREIPPRLFWHMPSLLTLSMSNNQLQH 253

  Fly   333 IKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNL--------------NGNRMKHL 383
            |.|.:|..|.||..|.|..|.|.||.:|:.|  .:||::.|.|              |...:::|
Zfish   254 IPPESFYYLPNLTKLTLYKNPLIFLPDQLIG--HMPRLQELYLYETNLVTVPSNLFANTTNLQYL 316

  Fly   384 H----------PL-AFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLE 437
            :          |. .|..||.|..|.|.||.|:.|...:|:.:.|||.|.|..|..|.:...:..
Zfish   317 NVHLNSNLTLLPKDVFCCLPNLRKLSLKHNNLRELHPEIFSNLNRLQILTLDGNKFESLPSTIFL 381

  Fly   438 SLSSVQEILVDNNRLTFL-AKVNVSFPNLKRVAIEGNPWQCPC-FVKLQHWLATRDVVYLRDN 498
            :.|.::.:.::.|.|.|| ..|.|....||.:.:..|.|.|.| .:....|        :|||
Zfish   382 NTSRLEILNLNQNHLRFLPGDVFVHAGALKVLTLSDNRWMCDCSILGFAEW--------IRDN 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 53/179 (30%)
LRR_8 104..164 CDD:290566 19/75 (25%)
leucine-rich repeat 106..129 CDD:275380 11/38 (29%)
leucine-rich repeat 130..153 CDD:275380 6/22 (27%)
leucine-rich repeat 154..195 CDD:275380 11/51 (22%)
LRR_RI 194..455 CDD:238064 89/293 (30%)
LRR_8 194..254 CDD:290566 24/67 (36%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
leucine-rich repeat 220..243 CDD:275380 10/22 (45%)
leucine-rich repeat 244..267 CDD:275380 9/22 (41%)
LRR_8 271..330 CDD:290566 18/58 (31%)
leucine-rich repeat 272..295 CDD:275380 8/22 (36%)
leucine-rich repeat 296..319 CDD:275380 6/22 (27%)
LRR_8 319..380 CDD:290566 23/74 (31%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 9/24 (38%)
LRR_8 368..428 CDD:290566 24/84 (29%)
leucine-rich repeat 370..393 CDD:275380 7/47 (15%)
leucine-rich repeat 394..417 CDD:275380 8/22 (36%)
leucine-rich repeat 418..441 CDD:275380 6/22 (27%)
LOC101884430XP_021325136.1 LRR_8 52..107 CDD:316378 14/55 (25%)
leucine-rich repeat 52..72 CDD:275380 6/20 (30%)
leucine-rich repeat 73..96 CDD:275380 5/22 (23%)
NEL <92..>362 CDD:330839 85/280 (30%)
leucine-rich repeat 97..120 CDD:275380 5/27 (19%)
leucine-rich repeat 121..144 CDD:275380 8/22 (36%)
leucine-rich repeat 145..168 CDD:275380 10/22 (45%)
leucine-rich repeat 169..192 CDD:275380 9/22 (41%)
leucine-rich repeat 193..216 CDD:275380 8/22 (36%)
leucine-rich repeat 217..240 CDD:275380 6/22 (27%)
leucine-rich repeat 241..264 CDD:275380 7/22 (32%)
leucine-rich repeat 265..288 CDD:275380 9/24 (38%)
leucine-rich repeat 289..312 CDD:275380 3/22 (14%)
leucine-rich repeat 313..335 CDD:275380 3/21 (14%)
LRR_8 336..396 CDD:316378 18/59 (31%)
leucine-rich repeat 338..359 CDD:275380 8/20 (40%)
leucine-rich repeat 362..385 CDD:275380 6/22 (27%)
leucine-rich repeat 386..406 CDD:275380 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.