| Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021322571.1 | Gene: | lrrc53 / 101882576 | ZFINID: | ZDB-GENE-131121-432 | Length: | 838 | Species: | Danio rerio |
| Alignment Length: | 271 | Identity: | 77/271 - (28%) |
|---|---|---|---|
| Similarity: | 117/271 - (43%) | Gaps: | 41/271 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 210 DVNAFRGLHGLLE-------LQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQN 267
Fly 268 FVLHLQQLDLSGNRI--RLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAI 330
Fly 331 LEIKPATF--AALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPF 393
Fly 394 LEYLKLGHNELK-SLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAK 457
Fly 458 VNVSFPNLKRV 468 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 14/52 (27%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 72/256 (28%) | ||
| LRR_8 | 194..254 | CDD:290566 | 13/50 (26%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 3/8 (38%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 6/29 (21%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 271..330 | CDD:290566 | 18/60 (30%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 8/24 (33%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 319..380 | CDD:290566 | 24/62 (39%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 8/24 (33%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 9/24 (38%) | ||
| LRR_8 | 368..428 | CDD:290566 | 18/60 (30%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 2/22 (9%) | ||
| lrrc53 | XP_021322571.1 | LRR_8 | 49..106 | CDD:316378 | 19/60 (32%) |
| leucine-rich repeat | 51..71 | CDD:275380 | 6/19 (32%) | ||
| leucine-rich repeat | 72..95 | CDD:275380 | 9/25 (36%) | ||
| LRR_8 | 96..156 | CDD:316378 | 18/59 (31%) | ||
| leucine-rich repeat | 96..121 | CDD:275380 | 8/24 (33%) | ||
| leucine-rich repeat | 122..145 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 146..206 | CDD:316378 | 24/61 (39%) | ||
| leucine-rich repeat | 146..171 | CDD:275380 | 8/24 (33%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 9/24 (38%) | ||
| leucine-rich repeat | 196..218 | CDD:275380 | 10/22 (45%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||