DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and lrrc4

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_002939414.1 Gene:lrrc4 / 100493671 XenbaseID:XB-GENE-968937 Length:641 Species:Xenopus tropicalis


Alignment Length:299 Identity:78/299 - (26%)
Similarity:119/299 - (39%) Gaps:57/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALD 255
            |:....:.|.|.:|.:..:..:.||.||.|..|||..|.:..|.:..|..||.|..|.|..|.|.
 Frog    66 GIPSNTRSLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLT 130

  Fly   256 ALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSR-NSIASLSPAHFVGLGS 319
            .:....|    .::..|::|.|..|.|..:....|..:..|..||:.. ..:..:|...|.||.:
 Frog   131 VIPSGAF----EYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLYN 191

  Fly   320 LRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLH 384
            |:.|.|....|.::...|  .|:.|:.|::|.||...::...|.|  |..:::|.:..:::..:.
 Frog   192 LKYLNLGMCNIRDMPNLT--PLVGLEELEISGNNFPEIKPGSFHG--LRSLKKLWIMNSQINTIE 252

  Fly   385 PLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDN 449
            ..||..|..|..|.|.||.:.||...:|||::.|.:|||.|                        
 Frog   253 RNAFDDLTSLVELNLAHNNVTSLPHDLFAPLKYLVELHLHH------------------------ 293

  Fly   450 NRLTFLAKVNVSFPNLKRVAIEGNPWQCPCFVK-LQHWL 487
                                   |||.|.|.|. |..||
 Frog   294 -----------------------NPWDCDCDVLWLSWWL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 22/64 (34%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380 1/3 (33%)
LRR_RI 194..455 CDD:238064 68/261 (26%)
LRR_8 194..254 CDD:290566 20/59 (34%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
leucine-rich repeat 220..243 CDD:275380 8/22 (36%)
leucine-rich repeat 244..267 CDD:275380 6/22 (27%)
LRR_8 271..330 CDD:290566 16/59 (27%)
leucine-rich repeat 272..295 CDD:275380 6/22 (27%)
leucine-rich repeat 296..319 CDD:275380 7/23 (30%)
LRR_8 319..380 CDD:290566 15/60 (25%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 8/24 (33%)
LRR_8 368..428 CDD:290566 19/59 (32%)
leucine-rich repeat 370..393 CDD:275380 4/22 (18%)
leucine-rich repeat 394..417 CDD:275380 10/22 (45%)
leucine-rich repeat 418..441 CDD:275380 5/22 (23%)
lrrc4XP_002939414.1 LRRNT 40..71 CDD:214470 1/4 (25%)
LRR <68..285 CDD:227223 63/224 (28%)
leucine-rich repeat 71..94 CDD:275380 6/22 (27%)
leucine-rich repeat 95..118 CDD:275380 8/22 (36%)
leucine-rich repeat 119..142 CDD:275380 6/26 (23%)
leucine-rich repeat 143..166 CDD:275380 6/22 (27%)
leucine-rich repeat 167..191 CDD:275380 7/23 (30%)
leucine-rich repeat 192..213 CDD:275380 6/22 (27%)
leucine-rich repeat 214..237 CDD:275380 8/24 (33%)
leucine-rich repeat 238..261 CDD:275380 4/22 (18%)
leucine-rich repeat 262..283 CDD:275380 9/20 (45%)
LRRCT 294..345 CDD:214507 9/16 (56%)
IG_like 353..435 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.