Sequence 1: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_004920451.1 | Gene: | tlr14.3 / 100485201 | XenbaseID: | XB-GENE-5909728 | Length: | 835 | Species: | Xenopus tropicalis |
Alignment Length: | 521 | Identity: | 118/521 - (22%) |
---|---|---|---|
Similarity: | 193/521 - (37%) | Gaps: | 151/521 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 LLDLDLTGAAPINVHTNGFSILPNLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRD 146
Fly 147 FFGNLRKLIYANFSHN----ALKQCDLPHMPLLNRLELGH---NRLVNATFGVCP--QLQELI-- 200
Fly 201 ---------------LNDNQL---IQLDVNAFRGLHGLLELQLSGNRLSSI-------------G 234
Fly 235 LETFQPLAQL------------------------RKLN--------------LSQNALD------ 255
Fly 256 ALR---------PNV---------FGAVQ---------NFV--------LHLQQLDLSGNRIRLL 285
Fly 286 FDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLS 350
Fly 351 YNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPF-LEYLKLGHNELKSLDVRMFAP 414
Fly 415 MRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNV-SFPNLKRVAIEGNPWQCP 478
Fly 479 C 479 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 46/238 (19%) |
LRR_8 | 104..164 | CDD:290566 | 17/63 (27%) | ||
leucine-rich repeat | 106..129 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 130..153 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 154..195 | CDD:275380 | 8/49 (16%) | ||
LRR_RI | 194..455 | CDD:238064 | 83/375 (22%) | ||
LRR_8 | 194..254 | CDD:290566 | 23/132 (17%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 10/42 (24%) | ||
leucine-rich repeat | 220..243 | CDD:275380 | 7/35 (20%) | ||
leucine-rich repeat | 244..267 | CDD:275380 | 12/93 (13%) | ||
LRR_8 | 271..330 | CDD:290566 | 16/58 (28%) | ||
leucine-rich repeat | 272..295 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 296..319 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 319..380 | CDD:290566 | 18/60 (30%) | ||
leucine-rich repeat | 320..343 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 344..369 | CDD:275380 | 9/24 (38%) | ||
LRR_8 | 368..428 | CDD:290566 | 18/60 (30%) | ||
leucine-rich repeat | 370..393 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 394..417 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 418..441 | CDD:275380 | 7/22 (32%) | ||
tlr14.3 | XP_004920451.1 | LRR_8 | 54..113 | CDD:338972 | 16/57 (28%) |
leucine-rich repeat | 55..78 | CDD:275378 | 5/22 (23%) | ||
leucine-rich repeat | 79..102 | CDD:275378 | 9/22 (41%) | ||
leucine-rich repeat | 103..126 | CDD:275378 | 4/22 (18%) | ||
leucine-rich repeat | 127..151 | CDD:275378 | 4/23 (17%) | ||
leucine-rich repeat | 364..391 | CDD:275380 | 10/28 (36%) | ||
leucine-rich repeat | 392..417 | CDD:275380 | 8/40 (20%) | ||
leucine-rich repeat | 418..440 | CDD:275380 | 9/24 (38%) | ||
leucine-rich repeat | 441..462 | CDD:275378 | 7/23 (30%) | ||
LRR_8 | 462..519 | CDD:338972 | 15/58 (26%) | ||
leucine-rich repeat | 463..486 | CDD:275378 | 6/22 (27%) | ||
leucine-rich repeat | 487..508 | CDD:275378 | 7/22 (32%) | ||
leucine-rich repeat | 509..532 | CDD:275378 | 3/22 (14%) | ||
leucine-rich repeat | 533..545 | CDD:275378 | 4/11 (36%) | ||
TIR | 651..788 | CDD:214587 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |