DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and lgr6

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_017209265.2 Gene:lgr6 / 100330212 -ID:- Length:962 Species:Danio rerio


Alignment Length:398 Identity:101/398 - (25%)
Similarity:159/398 - (39%) Gaps:95/398 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 QCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRL 230
            ||:...:.||  ::.....|.:....:.|....|.|:.|.:.::..||||.||.|.||:||||.|
Zfish    34 QCEEDGILLL--VDCSEQGLSSVPTDLSPLTSYLDLSMNNISEIQPNAFRNLHFLSELRLSGNHL 96

  Fly   231 SSIGLETFQPLAQLRKLNLSQNALDAL-------RPNVFG------------------------- 263
            ..|.....|.|..|:.|.|..|.|:.|       .||:..                         
Zfish    97 RHIPGPMLQGLYNLKVLMLQNNQLERLPSEDPWELPNLLSLRLDANLIMEVPARTLSGMRSLRHL 161

  Fly   264 ------------AVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVG 316
                        :..|.:..||.:.|:.|||.|:.|..||.|:.|.:|.:..|.|.:|....|.|
Zfish   162 WLDDNALTEIPVSALNDLSSLQAMTLALNRITLIPDYAFRNLSNLVVLHLHNNMIRTLGQNCFEG 226

  Fly   317 LGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQIFGGNT--------------- 366
            |.||..|.|.:|.:.|. |.....|..|..|....||::.:.|:.|.||.               
Zfish   227 LHSLETLELNFNDLQEF-PVAIRTLAKLQELGFHNNNIKAIPERAFVGNPLLQTIHFYENPIQFV 290

  Fly   367 -------LPRMRRLNLNGN---------------RMKHLHPLAFSSLPF--------LEYLKLGH 401
                   ||::..|:|||.               ::..|.....:|||:        |:.|:|.|
Zfish   291 GRSAFQFLPKLHTLSLNGATEIREFPDLKGTTSLQVLTLTRAGLTSLPYDLCHLLPKLKVLELSH 355

  Fly   402 NELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFL-AKVNVSFPNL 465
            |.::.|.  .|.....||::.|.|||:::|.::..:.|.|::.:.:..|.:..: .....|..:|
Zfish   356 NVIEELP--SFYHCTSLQEIGLQHNLIKQIEMNTFQQLGSLRSLDLSWNSINSIHPDAFFSLQSL 418

  Fly   466 KRVAIEGN 473
            .::.:.||
Zfish   419 IKLDLTGN 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 31/89 (35%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380 5/28 (18%)
LRR_RI 194..455 CDD:238064 92/349 (26%)
LRR_8 194..254 CDD:290566 25/59 (42%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
leucine-rich repeat 220..243 CDD:275380 11/22 (50%)
leucine-rich repeat 244..267 CDD:275380 8/66 (12%)
LRR_8 271..330 CDD:290566 24/58 (41%)
leucine-rich repeat 272..295 CDD:275380 11/22 (50%)
leucine-rich repeat 296..319 CDD:275380 8/22 (36%)
LRR_8 319..380 CDD:290566 22/97 (23%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 9/46 (20%)
LRR_8 368..428 CDD:290566 21/82 (26%)
leucine-rich repeat 370..393 CDD:275380 7/37 (19%)
leucine-rich repeat 394..417 CDD:275380 7/22 (32%)
leucine-rich repeat 418..441 CDD:275380 8/22 (36%)
lgr6XP_017209265.2 LRRNT 28..64 CDD:214470 6/31 (19%)
PLN00113 53..>448 CDD:331614 96/377 (25%)
leucine-rich repeat 62..85 CDD:275380 8/22 (36%)
leucine-rich repeat 86..109 CDD:275380 11/22 (50%)
leucine-rich repeat 110..133 CDD:275380 6/22 (27%)
leucine-rich repeat 134..157 CDD:275380 0/22 (0%)
leucine-rich repeat 158..181 CDD:275380 1/22 (5%)
leucine-rich repeat 182..205 CDD:275380 11/22 (50%)
leucine-rich repeat 206..229 CDD:275380 8/22 (36%)
leucine-rich repeat 230..252 CDD:275380 7/22 (32%)
leucine-rich repeat 253..276 CDD:275380 8/22 (36%)
leucine-rich repeat 277..298 CDD:275380 0/20 (0%)
leucine-rich repeat 324..338 CDD:275378 2/13 (15%)
leucine-rich repeat 348..369 CDD:275380 7/22 (32%)
leucine-rich repeat 370..393 CDD:275380 8/22 (36%)
leucine-rich repeat 394..417 CDD:275380 2/22 (9%)
leucine-rich repeat 418..438 CDD:275380 3/9 (33%)
7tmA_LGR6 554..829 CDD:320484
TM helix 1 555..581 CDD:320484
TM helix 2 588..613 CDD:320484
TM helix 3 633..663 CDD:320484
TM helix 4 675..697 CDD:320484
TM helix 5 719..748 CDD:320484
TM helix 6 757..787 CDD:320484
TM helix 7 797..822 CDD:320484
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.