DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6749 and dcn

DIOPT Version :9

Sequence 1:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001093704.1 Gene:dcn / 100101716 XenbaseID:XB-GENE-485545 Length:364 Species:Xenopus tropicalis


Alignment Length:328 Identity:78/328 - (23%)
Similarity:133/328 - (40%) Gaps:76/328 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 NLRQLNLSGCGLVDIRGNHFAPE---SALQRIDFSHNQM-ELLDRDF--FGNLRKLIYANFSHNA 163
            :||.:..|..||..:      |:   |....:|..:|:: |:.:.||  ..||..||..|....:
 Frog    66 HLRVVQCSDIGLEQV------PKDIPSDTTLLDLQNNKITEIKEGDFKNLKNLHALILVNNKIKS 124

  Fly   164 LKQCDLPHMPLLNRLELGHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGN 228
            :.......:..|.||.|..|.|.:....:...||||.:::|.:.:|..:.|.||:.::.::|..|
 Frog   125 ISPSAFASLTKLERLYLSKNNLKDLPANMPKSLQELRVHENSITKLKKSVFDGLNNMIVVELGTN 189

  Fly   229 RLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVL 293
            .:.|.|:|.                         ||.|.                      .:.|
 Frog   190 PIESSGVEK-------------------------GAFQG----------------------MKKL 207

  Fly   294 ARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLE 358
            :.|::.|.:..||....||      ||.:|:|..|.|.::...:...|.||..|.|||||:..||
 Frog   208 SYLRIADTNITSIPKGLPA------SLTELHLDGNKIAKVDSDSLNGLNNLAKLGLSYNNIITLE 266

  Fly   359 EQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHL 423
            .....|  :|.:|.|:|:.|.:..: |.......:::.:.|.:|::.::....|.|        |
 Frog   267 NGTVTG--VPHLRELHLDHNSLTQV-PAGLGEHKYIQVVYLHNNKISAVSTNDFCP--------L 320

  Fly   424 GHN 426
            |:|
 Frog   321 GYN 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 37/156 (24%)
LRR_8 104..164 CDD:290566 17/64 (27%)
leucine-rich repeat 106..129 CDD:275380 6/25 (24%)
leucine-rich repeat 130..153 CDD:275380 7/25 (28%)
leucine-rich repeat 154..195 CDD:275380 9/40 (23%)
LRR_RI 194..455 CDD:238064 55/233 (24%)
LRR_8 194..254 CDD:290566 14/59 (24%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
leucine-rich repeat 220..243 CDD:275380 5/22 (23%)
leucine-rich repeat 244..267 CDD:275380 2/22 (9%)
LRR_8 271..330 CDD:290566 12/58 (21%)
leucine-rich repeat 272..295 CDD:275380 1/22 (5%)
leucine-rich repeat 296..319 CDD:275380 6/22 (27%)
LRR_8 319..380 CDD:290566 23/60 (38%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..369 CDD:275380 10/24 (42%)
LRR_8 368..428 CDD:290566 13/59 (22%)
leucine-rich repeat 370..393 CDD:275380 5/22 (23%)
leucine-rich repeat 394..417 CDD:275380 4/22 (18%)
leucine-rich repeat 418..441 CDD:275380 3/9 (33%)
dcnNP_001093704.1 LRRNT 58..90 CDD:214470 7/29 (24%)
leucine-rich repeat 67..87 CDD:275380 6/25 (24%)
PRK15370 <75..>303 CDD:185268 68/289 (24%)
leucine-rich repeat 88..111 CDD:275380 5/22 (23%)
leucine-rich repeat 112..135 CDD:275380 4/22 (18%)
leucine-rich repeat 136..156 CDD:275380 6/19 (32%)
leucine-rich repeat 157..180 CDD:275380 9/22 (41%)
leucine-rich repeat 181..206 CDD:275380 8/71 (11%)
leucine-rich repeat 207..227 CDD:275380 7/25 (28%)
leucine-rich repeat 228..251 CDD:275380 6/22 (27%)
leucine-rich repeat 252..275 CDD:275380 10/24 (42%)
leucine-rich repeat 299..320 CDD:275380 4/28 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.