DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynB and ATP4

DIOPT Version :9

Sequence 1:NP_524011.1 Gene:ATPsynB / 39143 FlyBaseID:FBgn0019644 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_015247.1 Gene:ATP4 / 856027 SGDID:S000005999 Length:244 Species:Saccharomyces cerevisiae


Alignment Length:184 Identity:46/184 - (25%)
Similarity:88/184 - (47%) Gaps:6/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KTGVTGPYTFGVGLITYLCSKEIYVMEHEYYSGLS-LGIMAIIAVKKLGPVIAKWADGEIDKIES 123
            ||||.|.   ....:.|..|.|:||:..|....|: ||...::| |.|.|....:||..:.|:..
Yeast    65 KTGVLGT---SAAAVIYAISNELYVINDESILLLTFLGFTGLVA-KYLAPAYKDFADARMKKVSD 125

  Fly   124 EWKEGREAELKVLSDAIEAEKKEQWRADGALLLMEAKKENIALQLEAAFRERAMNVYSEVKRRLD 188
            .....|...::.:.|.|::..:.|..|:...:|.:..||.:.|:.||...::.:.:..|.|..||
Yeast   126 VLNASRNKHVEAVKDRIDSVSQLQNVAETTKVLFDVSKETVELESEAFELKQKVELAHEAKAVLD 190

  Fly   189 YQVECRHVERRLSQKHMVNWITTNVLASI-SPQQEKETLNKCIADLSALALRVK 241
            ..|......|:|.|:.:...:.:.|.:.: :|:.:::.|.:.|:::..|..::|
Yeast   191 SWVRYEASLRQLEQRQLAKSVISRVQSELGNPKFQEKVLQQSISEIEQLLSKLK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynBNP_524011.1 Mt_ATP-synt_B 73..233 CDD:368426 39/161 (24%)
ATP4NP_015247.1 Mt_ATP-synt_B 75..237 CDD:368426 39/162 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344337
Domainoid 1 1.000 55 1.000 Domainoid score I2752
eggNOG 1 0.900 - - E1_KOG3976
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I1760
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto100292
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12733
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3753
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.