DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynB and CG17300

DIOPT Version :9

Sequence 1:NP_524011.1 Gene:ATPsynB / 39143 FlyBaseID:FBgn0019644 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_648631.1 Gene:CG17300 / 39489 FlyBaseID:FBgn0036345 Length:152 Species:Drosophila melanogaster


Alignment Length:152 Identity:66/152 - (43%)
Similarity:85/152 - (55%) Gaps:34/152 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSRAALLTAQRPLTVAATRSAAAAAAPGGAIERRQRPEH--PGKVRLGFLPEEWFQFFYNKTGV 63
            ||||.||    ||||||.:|||...:|.|    ..:.|.|  |||||.||..:.|         |
  Fly     1 MFSRLAL----RPLTVATSRSATTHSAQG----LSRLPGHGSPGKVRPGFPSDNW---------V 48

  Fly    64 TGPYTFGVGLITYLCSKEIYVMEHE-------------YYSGLSLGIMAIIAVKKLGPVIAKWAD 115
            .||  .||||:.|:||.:...::||             |.||:::||:...||.:|.|.|.||||
  Fly    49 KGP--MGVGLLAYICSGDCCAIKHEHSGLSLGIMEDGYYSSGITIGILTTFAVIRLLPAIVKWAD 111

  Fly   116 GEIDKIESEWKEGREAELKVLS 137
            .||.|||||:::.||.::||||
  Fly   112 SEIIKIESEYEKSRETKIKVLS 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynBNP_524011.1 Mt_ATP-synt_B 73..233 CDD:368426 33/78 (42%)
CG17300NP_648631.1 ATP-synt_B 79..>133 CDD:304375 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3976
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I1760
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1314411at2759
OrthoFinder 1 1.000 - - FOG0005510
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12733
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.