DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynB and atp4

DIOPT Version :9

Sequence 1:NP_524011.1 Gene:ATPsynB / 39143 FlyBaseID:FBgn0019644 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_596633.1 Gene:atp4 / 2539732 PomBaseID:SPBC1604.07 Length:244 Species:Schizosaccharomyces pombe


Alignment Length:233 Identity:51/233 - (21%)
Similarity:88/233 - (37%) Gaps:20/233 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TAQRPLTVAATRSAAAA-----AAPGGAIERRQRPEHPGKVRLGFLPEEWFQFFYNKTGVTGPYT 68
            ||.:.|.:.:||..:..     ..|.|.|.    |:......:..:|.   .....|:||   .|
pombe    17 TAWQRLVLPSTRKFSLTPTTFDKTPSGRIP----PDQKAANIISSVPS---TSLLTKSGV---LT 71

  Fly    69 FGVGLITYLCSKEIYVMEHEYYSGLS-LGIMAIIAVKKLG-PVIAKWADGEIDKIESEWKEGREA 131
            .....:....||.|||:..|.....| ||::.:...  || ....:|:|..|.||....:..|..
pombe    72 VTAAALATAISKGIYVVNDESIVVASFLGLVGVFGT--LGRKAYNEWSDKTIAKIGGIMQAARND 134

  Fly   132 ELKVLSDAIEAEKKEQWRADGALLLMEAKKENIALQLEAAFRERAMNVYSEVKRRLDYQVECRHV 196
            ....:.:.|:.....|........|....||...::.|....|:.:.:..|.|..||..|.....
pombe   135 HTSAIRERIDQVASLQEVESVTQALFHTSKETARMEAEIFELEQRVALAKEAKSVLDSWVHHEAN 199

  Fly   197 ERRLSQKHMVNWITTNVLASISPQQ-EKETLNKCIADL 233
            .|...|:.:|..:...|.:.:|.|: :::.||:.:.::
pombe   200 VRAEQQERLVEDVLARVNSKVSTQKFQQDALNESLGEI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynBNP_524011.1 Mt_ATP-synt_B 73..233 CDD:368426 37/162 (23%)
atp4NP_596633.1 Mt_ATP-synt_B 81..238 CDD:283144 37/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3976
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12733
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3753
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.990

Return to query results.
Submit another query.