DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynB and Atp5pb

DIOPT Version :9

Sequence 1:NP_524011.1 Gene:ATPsynB / 39143 FlyBaseID:FBgn0019644 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_599192.1 Gene:Atp5pb / 171375 RGDID:620041 Length:256 Species:Rattus norvegicus


Alignment Length:269 Identity:106/269 - (39%)
Similarity:144/269 - (53%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSRAALLTAQRPLTVAATRSAAAAAAP--------GGAIERRQR---------------PEHPG 42
            |.||..|             ||||.|||        |..:.:..|               ||:.|
  Rat     1 MLSRVVL-------------SAAATAAPCLKNAAVLGPGVLQATRVFHTGQPRLAPLPPLPEYGG 52

  Fly    43 KVRLGFLPEEWFQFFYNKTGVTGPYTFGVGLITYLCSKEIYVMEHEYYSGLSLGIMAIIAVKKLG 107
            |||||.:|||:|||.|.||||||||..|.||..|..||||||:..|.:|.:|:..:.:..:||.|
  Rat    53 KVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYVITPETFSTISVVGLIVYVIKKYG 117

  Fly   108 PVIAKWADGEIDKIESE----WKEGREAELKVLSDAIEAEKKEQWRADGALLLMEAKKENIALQL 168
            ..|.::    |||:..|    .:|.:::.:|.:.|||..||.:|........|.:.::.||||.|
  Rat   118 ASIGEF----IDKLNEEKIAQLEEIKQSSMKQIQDAINREKAQQALVQKRHYLFDVQRNNIALAL 178

  Fly   169 EAAFRERAMNVYSEVKRRLDYQVECRHVERRLSQKHMVNWITTNVLASISPQQEKETLNKCIADL 233
            |..:|||....|.|||.||||.:..:.:.||...:||:||:..:|:.|||.||||||:.|||.||
  Rat   179 EVTYRERLHKAYKEVKNRLDYHISVQDMMRRKEGEHMINWVEKHVIQSISAQQEKETIAKCIGDL 243

  Fly   234 SALALRVKS 242
            ..||.:.::
  Rat   244 KMLAKKAQA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynBNP_524011.1 Mt_ATP-synt_B 73..233 CDD:368426 64/163 (39%)
Atp5pbNP_599192.1 Mt_ATP-synt_B 83..244 CDD:283144 65/164 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343262
Domainoid 1 1.000 121 1.000 Domainoid score I5597
eggNOG 1 0.900 - - E1_KOG3976
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1275
Inparanoid 1 1.050 178 1.000 Inparanoid score I3917
OMA 1 1.010 - - QHG52501
OrthoDB 1 1.010 - - D1314411at2759
OrthoFinder 1 1.000 - - FOG0005510
OrthoInspector 1 1.000 - - oto98649
orthoMCL 1 0.900 - - OOG6_106091
Panther 1 1.100 - - LDO PTHR12733
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4458
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.