DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynB and Atp5pb

DIOPT Version :9

Sequence 1:NP_524011.1 Gene:ATPsynB / 39143 FlyBaseID:FBgn0019644 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_033855.2 Gene:Atp5pb / 11950 MGIID:1100495 Length:256 Species:Mus musculus


Alignment Length:259 Identity:104/259 - (40%)
Similarity:144/259 - (55%) Gaps:24/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSRAALLTAQRPLTVAATRSAAAAAAPGGAIERR-------------QRPEHPGKVRLGFLPEE 52
            |.||..|..|   .|.|.....|||..||.....|             ..||:.||||||.:|||
Mouse     1 MLSRVVLSAA---ATAAPCLKNAAALGPGVLQATRAFHTGQPRLAPLPPLPEYGGKVRLGLIPEE 62

  Fly    53 WFQFFYNKTGVTGPYTFGVGLITYLCSKEIYVMEHEYYSGLSLGIMAIIAVKKLGPVIAKWADGE 117
            :|||.|.||||||||..|.||..|..||||||:..|.:|.:|:..:.:..:||.|....::    
Mouse    63 FFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYVITPETFSTISVVGLIVYVIKKYGASFGEF---- 123

  Fly   118 IDKIESE----WKEGREAELKVLSDAIEAEKKEQWRADGALLLMEAKKENIALQLEAAFRERAMN 178
            |||:..|    .:|.:::.:|.:.|||:.||.:|........|.:.::.||||.||..:|||...
Mouse   124 IDKLNEEKIAQLEEVKQSSMKQIQDAIDMEKAQQALVQKRHYLFDVQRNNIALALEVTYRERLHK 188

  Fly   179 VYSEVKRRLDYQVECRHVERRLSQKHMVNWITTNVLASISPQQEKETLNKCIADLSALALRVKS 242
            .|.|||.||||.:..:::.||..::||::|:..:|:.|||.||||||:.|||.||..||.:.::
Mouse   189 AYKEVKNRLDYHISVQNMMRRKEEEHMIDWVEKHVVKSISVQQEKETIAKCIEDLKLLAKKAQA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynBNP_524011.1 Mt_ATP-synt_B 73..233 CDD:368426 62/163 (38%)
Atp5pbNP_033855.2 Mt_ATP-synt_B 83..244 CDD:368426 63/164 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839445
Domainoid 1 1.000 119 1.000 Domainoid score I5798
eggNOG 1 0.900 - - E1_KOG3976
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1275
Inparanoid 1 1.050 178 1.000 Inparanoid score I4012
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52501
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005510
OrthoInspector 1 1.000 - - oto95160
orthoMCL 1 0.900 - - OOG6_106091
Panther 1 1.100 - - LDO PTHR12733
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3753
SonicParanoid 1 1.000 - - X4458
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.