powered by:
Protein Alignment Naa60 and Nat8f3
DIOPT Version :9
Sequence 1: | NP_996032.1 |
Gene: | Naa60 / 39142 |
FlyBaseID: | FBgn0036039 |
Length: | 276 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001032931.1 |
Gene: | Nat8f3 / 93674 |
MGIID: | 2136449 |
Length: | 227 |
Species: | Mus musculus |
Alignment Length: | 73 |
Identity: | 19/73 - (26%) |
Similarity: | 30/73 - (41%) |
Gaps: | 5/73 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 140 ILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKRRF--TLHSF 202
:|.|.|...|||.|:|..::..: |..|:......:.|.|......|:..|:...| |..:|
Mouse 139 LLHLSVSLQHRREGLGKAMVRTV---LQFAQMQGFSEVVLSTSMLQYAALALYQGMGFQKTGETF 200
Fly 203 LPYYYNIR 210
..|...:|
Mouse 201 YTYLSRLR 208
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0456 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.