DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and Nat8f3

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001032931.1 Gene:Nat8f3 / 93674 MGIID:2136449 Length:227 Species:Mus musculus


Alignment Length:73 Identity:19/73 - (26%)
Similarity:30/73 - (41%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 ILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKRRF--TLHSF 202
            :|.|.|...|||.|:|..::..:   |..|:......:.|.|......|:..|:...|  |..:|
Mouse   139 LLHLSVSLQHRREGLGKAMVRTV---LQFAQMQGFSEVVLSTSMLQYAALALYQGMGFQKTGETF 200

  Fly   203 LPYYYNIR 210
            ..|...:|
Mouse   201 YTYLSRLR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 18/68 (26%)
Acetyltransf_1 <136..198 CDD:278980 15/59 (25%)
Nat8f3NP_001032931.1 Acetyltransf_7 106..195 CDD:379228 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.