DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and Nat8f2

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_444326.2 Gene:Nat8f2 / 93673 MGIID:2136446 Length:238 Species:Mus musculus


Alignment Length:189 Identity:38/189 - (20%)
Similarity:69/189 - (36%) Gaps:48/189 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LAAVYN-LAIIGL-IVAEIKPYRNVNKEVIANMSDSDELYTRLSGF-----------------PM 121
            ||.:|: |.::.| ::..|.....|.|.:.|:::|..:.|....|.                 |:
Mouse    62 LATLYSFLFLLCLWLIFWISCRNYVAKSLQADLADITKSYLNAHGSFWVAESGDQVVGMVGAQPV 126

  Fly   122 QDKGILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMNHL-----------TTAERHSVK 175
            :|..:....|       .:..|.|...||..||...|:..::...           |.:.:||.:
Mouse   127 KDPPLGKKQM-------QLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYSDVVLETGSVQHSAQ 184

  Fly   176 AIFLHTLTTNQPAIFF--YEKRRFTLHSFLPYYYNI---RGKGKDGFTYVNYINGGHPP 229
            |:: ..:...:...:|  ..|:...| |.|.:.|::   .|.|..|    .|:..|..|
Mouse   185 ALY-QAMGFQKTGQYFVSISKKLMGL-SILQFSYSLPFASGPGYSG----KYLKKGPIP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 31/162 (19%)
Acetyltransf_1 <136..198 CDD:278980 13/74 (18%)
Nat8f2NP_444326.2 RimI <88..197 CDD:223532 19/116 (16%)
Acetyltransf_1 112..193 CDD:278980 14/88 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.