DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and AT5G16800

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001190321.1 Gene:AT5G16800 / 831543 AraportID:AT5G16800 Length:273 Species:Arabidopsis thaliana


Alignment Length:243 Identity:61/243 - (25%)
Similarity:107/243 - (44%) Gaps:55/243 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PDDLTEVRQLCQEWFPIDYPLSWYEDITSSTRFFALAAV-------YNLAIIGLIVAEIKPYRNV 98
            |.||..:.|:.::.|||.|...:::::.:.....:.|||       ::..:||.:.|:|      
plant    32 PSDLERLEQIHRDIFPIRYESEFFQNVVNGGDIVSWAAVDRSRPDGHSEELIGFVTAKI------ 90

  Fly    99 NKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALM 163
               |:|..|:..:|             |..||......:.|||:|||..::|:.||...|::.::
plant    91 ---VLAKESEISDL-------------IRYDSSKGEGTLVYILTLGVVETYRKRGIAKALINEVV 139

  Fly   164 NHLTTAERHSVKAIFLHTLTTNQPAIFFYEKRRF----TLHSFLPYYYNIRGKGKDGFTYVNYIN 224
            .:  ::.....:.::||.:..|.|||..|::..|    .||.|    |.|.|:..|.:.:|.:||
plant   140 KY--SSGIPVCRGVYLHVIAHNNPAIRLYKRMSFRCVRRLHGF----YLINGQHFDSYLFVYFIN 198

  Fly   225 GG--HPPW--------TLLDH----IKHYAS--MVRHTSSLCAWLAGR 256
            .|  ...|        .:|::    ||.:||  .|.|......||..:
plant   199 DGVIAESWLHCRDLAVLVLNYMRSGIKSFASKLTVNHDEKGSKWLKSK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 35/143 (24%)
Acetyltransf_1 <136..198 CDD:278980 18/65 (28%)
AT5G16800NP_001190321.1 RimI 27..181 CDD:223532 43/176 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I2488
OMA 1 1.010 - - QHG58755
OrthoDB 1 1.010 - - D1619974at2759
OrthoFinder 1 1.000 - - FOG0005438
OrthoInspector 1 1.000 - - otm2703
orthoMCL 1 0.900 - - OOG6_104382
Panther 1 1.100 - - LDO PTHR14744
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.