Sequence 1: | NP_996032.1 | Gene: | Naa60 / 39142 | FlyBaseID: | FBgn0036039 | Length: | 276 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003482.1 | Gene: | NAA10 / 8260 | HGNCID: | 18704 | Length: | 235 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 44/197 - (22%) |
---|---|---|---|
Similarity: | 74/197 - (37%) | Gaps: | 65/197 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 VQLRFLVPDDLTEVRQ---LCQEWFPIDYPLSWYEDITSSTRFF---------ALAAVYNLAIIG 86
Fly 87 LIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRR 151
Fly 152 NGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKR-RFTLHSFLPYYYNIRGKGKD 215
Fly 216 GF 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Naa60 | NP_996032.1 | RimI | 74..207 | CDD:223532 | 30/142 (21%) |
Acetyltransf_1 | <136..198 | CDD:278980 | 20/62 (32%) | ||
NAA10 | NP_003482.1 | RimI | 1..149 | CDD:223532 | 44/197 (22%) |
Interaction with NAA15. /evidence=ECO:0000269|PubMed:15496142 | 1..58 | 14/67 (21%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 178..235 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0456 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |