DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and NAA10

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_003482.1 Gene:NAA10 / 8260 HGNCID:18704 Length:235 Species:Homo sapiens


Alignment Length:197 Identity:44/197 - (22%)
Similarity:74/197 - (37%) Gaps:65/197 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VQLRFLVPDDLTEVRQ---LCQEWFPIDYPLSWYEDITSSTRFF---------ALAAVYNLAIIG 86
            :.:|...|:||..::.   ||   .|.:|.:.:|        |:         .:|...|..|:|
Human     1 MNIRNARPEDLMNMQHCNLLC---LPENYQMKYY--------FYHGLSWPQLSYIAEDENGKIVG 54

  Fly    87 LIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRR 151
            .::|:::                            :|    ||.:..    |:|.||.|.|||||
Human    55 YVLAKME----------------------------ED----PDDVPH----GHITSLAVKRSHRR 83

  Fly   152 NGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKR-RFTLHSFLPYYYNIRGKGKD 215
            .|:...|:|.....:  .|..:.|.:.||...:|:.|:..|... .|.:....|.||   ..|:|
Human    84 LGLAQKLMDQASRAM--IENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYY---ADGED 143

  Fly   216 GF 217
            .:
Human   144 AY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 30/142 (21%)
Acetyltransf_1 <136..198 CDD:278980 20/62 (32%)
NAA10NP_003482.1 RimI 1..149 CDD:223532 44/197 (22%)
Interaction with NAA15. /evidence=ECO:0000269|PubMed:15496142 1..58 14/67 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..235
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.