DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and MCC1

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_186948.1 Gene:MCC1 / 821166 AraportID:AT3G02980 Length:247 Species:Arabidopsis thaliana


Alignment Length:257 Identity:66/257 - (25%)
Similarity:115/257 - (44%) Gaps:48/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VPLCSINDVQLRFLVPDDLTEVRQLCQEWFPIDYPLSWYEDITSSTRFFALAAV-------YNLA 83
            :.||.  .:..|.:.|:||..:.|:.::.|||.|...:::.:.:.....:.|||       ::..
plant    19 ISLCP--SIHYRPINPNDLDRLEQIHRDIFPIKYESEFFQSVVNGVDIVSWAAVDRSRPDDHSDE 81

  Fly    84 IIGLIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRS 148
            :||.:.|         |.|:|..|:.|:|             |..||......:.|||:|||..:
plant    82 LIGFVTA---------KFVLAKDSEIDDL-------------IHYDSSKGEETLIYILTLGVVET 124

  Fly   149 HRRNGIGSLLLDALMNHLTTAERHSV-KAIFLHTLTTNQPAIFFYEKRRF----TLHSFLPYYYN 208
            :|..||...|:..::.:   |...|| :.::||.:..|..||..|::..|    .||.|    |.
plant   125 YRNRGIAMSLISEVIKY---ASGLSVCRGVYLHVIAHNNAAICLYKRLMFRCVRRLHGF----YL 182

  Fly   209 IRGKGKDGFTYVNYINGGHPPWTLLD---HIKHYASMVRHTSSLCAWLAGRVQQVVRWFYHK 267
            |.....|.|.:|.:|||...|.:.|:   .:.:|  |.....|:.:.||.:.::.::|.:.|
plant   183 INRHHFDAFLFVYFINGSRTPCSPLEVAMFVVNY--MKSGIKSVASKLANKDEKGLKWLFCK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 38/144 (26%)
Acetyltransf_1 <136..198 CDD:278980 20/66 (30%)
MCC1NP_186948.1 RimI 27..199 CDD:223532 53/200 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I2488
OMA 1 1.010 - - QHG58755
OrthoDB 1 1.010 - - D1619974at2759
OrthoFinder 1 1.000 - - FOG0005438
OrthoInspector 1 1.000 - - otm2703
orthoMCL 1 0.900 - - OOG6_104382
Panther 1 1.100 - - O PTHR14744
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.