DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and NAA60

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001304022.1 Gene:NAA60 / 79903 HGNCID:25875 Length:249 Species:Homo sapiens


Alignment Length:215 Identity:103/215 - (47%)
Similarity:131/215 - (60%) Gaps:27/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DYPLSWYEDITSSTRFFALAAVYNLAIIGLIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQ 122
            :||.|||.||||:.:||:|||.|..||:|:||||||....::||                     
Human    44 EYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAEIKNRTKIHKE--------------------- 87

  Fly   123 DKGILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQP 187
            |..||..:......|.|||||||.:..|::|||||||::|.:|::|..:...|||:||.||||..
Human    88 DGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNT 152

  Fly   188 AIFFYEKRRFTLHSFLPYYYNIRGKGKDGFTYVNYINGGHPPWTLLDHIKHYASMVRHTSSLCAW 252
            ||.|||.|.|..|.:|||||:|||..|||||||.||||||||||:||:|:|..|.:...|. |: 
Human   153 AINFYENRDFKQHHYLPYYYSIRGVLKDGFTYVLYINGGHPPWTILDYIQHLGSALASLSP-CS- 215

  Fly   253 LAGRVQQVVRWFYHKLLTRF 272
            :..||.:..    |.||..|
Human   216 IPHRVYRQA----HSLLCSF 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 58/132 (44%)
Acetyltransf_1 <136..198 CDD:278980 34/61 (56%)
NAA60NP_001304022.1 RimI <44..173 CDD:223532 69/149 (46%)
Acetyltransf_1 86..163 CDD:278980 39/97 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147265
Domainoid 1 1.000 115 1.000 Domainoid score I6047
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32610
Inparanoid 1 1.050 220 1.000 Inparanoid score I3571
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58755
OrthoDB 1 1.010 - - D1619974at2759
OrthoFinder 1 1.000 - - FOG0005438
OrthoInspector 1 1.000 - - oto91782
orthoMCL 1 0.900 - - OOG6_104382
Panther 1 1.100 - - LDO PTHR14744
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2980
SonicParanoid 1 1.000 - - X5008
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.