DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and Nat8f1

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_006506533.1 Gene:Nat8f1 / 66116 MGIID:1913366 Length:232 Species:Mus musculus


Alignment Length:159 Identity:33/159 - (20%)
Similarity:60/159 - (37%) Gaps:18/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ITSSTRFFALAAVYNLAIIGLIVAEIKPYRN-VNKEVIANMSDSDELYTRLSGFPM-------QD 123
            :.|.:...|:..::.|.::..::|. :|::. |.|.:..:|.|..:.|..:.|...       |.
Mouse    65 LVSGSWILAVICIFFLLLLLRLLAR-QPWKEYVAKCLQTDMVDITKSYLNVHGACFWVAESGGQV 128

  Fly   124 KGILPDSMGRSADVG----YILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTT 184
            .||:.....:...:|    .:..|.|...||..||...|...:   |..|...|...:.|.|...
Mouse   129 VGIVAAQPVKDPPLGRKQLQLFRLSVSSQHRGQGIAKALTRTV---LQFARDQSYSDVVLETSAL 190

  Fly   185 NQPAIFFYEKRRFTL--HSFLPYYYNIRG 211
            .|.|:..|....|..  ..|:..::.:.|
Mouse   191 QQGAVTLYLGMGFKKAGQYFMSIFWRLAG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 31/146 (21%)
Acetyltransf_1 <136..198 CDD:278980 16/65 (25%)
Nat8f1XP_006506533.1 Acetyltransf_1 101..203 CDD:366181 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.