DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and san

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster


Alignment Length:177 Identity:44/177 - (24%)
Similarity:75/177 - (42%) Gaps:42/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NDVQLRFLVPDDLTEVRQLCQEWFPIDYPLSWYEDITSSTRFFALAAVYNLAIIGLIVAEIKPYR 96
            :.::|..:.|.::.::::|....||:.|...:|.|:..:.. .|..|.||..::|.:...|    
  Fly     4 SSIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGE-LAKLAYYNDIVVGAVCCRI---- 63

  Fly    97 NVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDA 161
                       |:.|...||                      ||::||....:||.|||:::.:.
  Fly    64 -----------DNTENQRRL----------------------YIMTLGCLSPYRRLGIGTVMFEH 95

  Fly   162 LMNHLTTAERH-SVKAIFLHTLTTNQPAIFFYEKRRFTLHSFLPYYY 207
            :||.   ||:. :..:||||....|..||.||:|..|.:......||
  Fly    96 IMNF---AEKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQYY 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 34/133 (26%)
Acetyltransf_1 <136..198 CDD:278980 23/62 (37%)
sanNP_524779.1 RimI <27..145 CDD:223532 41/154 (27%)
Acetyltransf_1 50..130 CDD:278980 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.