DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and naa50

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_005162748.1 Gene:naa50 / 445229 ZFINID:ZDB-GENE-040801-142 Length:169 Species:Danio rerio


Alignment Length:175 Identity:40/175 - (22%)
Similarity:73/175 - (41%) Gaps:42/175 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VQLRFLVPDDLTEVRQLCQEWFPIDYPLSWYEDITSSTRFFALAAVYNLAIIGLIVAEIKPYRNV 98
            ::|..:.|.::.::::|.|..||:.|...:|:|:..... .|..|.:|...:|.:...:      
Zfish     6 IELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGE-LAKLAYFNDIAVGAVCCRV------ 63

  Fly    99 NKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALM 163
                     |..:...||                      ||::||....:||.|||:.:|:.::
Zfish    64 ---------DHSQNQKRL----------------------YIMTLGCLAPYRRLGIGTKMLNHVL 97

  Fly   164 NHLTTAERH-SVKAIFLHTLTTNQPAIFFYEKRRFTLHSFLPYYY 207
            |   ..|:. :...|:||...:|:.||.||:|..|.:......||
Zfish    98 N---ICEKDGTFDNIYLHVQISNESAIDFYQKFGFEIIETKKNYY 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 29/133 (22%)
Acetyltransf_1 <136..198 CDD:278980 21/62 (34%)
naa50XP_005162748.1 RimI 10..145 CDD:223532 39/171 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.