DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and vnc

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_648378.1 Gene:vnc / 39175 FlyBaseID:FBgn0263251 Length:196 Species:Drosophila melanogaster


Alignment Length:199 Identity:47/199 - (23%)
Similarity:76/199 - (38%) Gaps:67/199 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VQLRFLVPDDLTEVRQ---LCQEWFPIDYPLSWYEDITSSTRFF--------ALAAVYNL-AIIG 86
            :.:|...|:||..::.   ||   .|.:|.:.:|        |:        :..||.:. ||:|
  Fly     1 MNIRCAKPEDLMTMQHCNLLC---LPENYQMKYY--------FYHGLTWPQLSYVAVDDKGAIVG 54

  Fly    87 LIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRR 151
            .              |:|.|.:.:                 |:...|.   |:|.||.|.||:||
  Fly    55 Y--------------VLAKMEEPE-----------------PNEESRH---GHITSLAVKRSYRR 85

  Fly   152 NGIGSLLLDALMNHLTTA--ERHSVKAIFLHTLTTNQPAIFFYEKR-RFTLHSFLPYYYNIRGKG 213
            .|    |...|||..:.|  |..:.:.:.||...:|:.|:..|... :|.:....|.||   ..|
  Fly    86 LG----LAQKLMNQASQAMVECFNAQYVSLHVRKSNRAALNLYTNALKFKIIEVEPKYY---ADG 143

  Fly   214 KDGF 217
            :|.:
  Fly   144 EDAY 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 33/144 (23%)
Acetyltransf_1 <136..198 CDD:278980 21/64 (33%)
vncNP_648378.1 RimI 1..151 CDD:223532 47/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.