DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and Naa20

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001102065.1 Gene:Naa20 / 362228 RGDID:1307713 Length:188 Species:Rattus norvegicus


Alignment Length:192 Identity:39/192 - (20%)
Similarity:69/192 - (35%) Gaps:43/192 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LCSINDVQLRFLVPDDLTEVRQLCQEWFPIDYPLSWYEDITSSTRFFALAAVYNLAIIGLIVAEI 92
            |...|::.|     |.|||...:.   |.:.|...|.|       :|.:|......::|.     
  Rat    12 LFRFNNINL-----DPLTETYGIP---FYLQYLAHWPE-------YFIVAEAPGGELMGY----- 56

  Fly    93 KPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRRNGIGSL 157
                              ..|:..|.|.:..|.  ..|:.|....|::.:|.|....||.|:.:.
  Rat    57 ------------------SKYSTTSTFLVMGKA--EGSVAREEWHGHVTALSVAPEFRRLGLAAK 101

  Fly   158 LLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKRRFTLHSFLPYYYNIRGKGKDGFTY 219
            |::.|..   .:||.....:.|....:||.|:..|::..::::..:..||:......|...|
  Rat   102 LMELLEE---ISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 24/132 (18%)
Acetyltransf_1 <136..198 CDD:278980 15/61 (25%)
Naa20NP_001102065.1 RimI 1..166 CDD:223532 39/192 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.