DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and F30F8.10

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001382268.1 Gene:F30F8.10 / 3565178 WormBaseID:WBGene00009277 Length:245 Species:Caenorhabditis elegans


Alignment Length:252 Identity:85/252 - (33%)
Similarity:121/252 - (48%) Gaps:48/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PSSESTRVDCEHVPLCSINDVQLRFLVPDDLTEVRQLCQEWFPIDYPLSWYEDITS----STRFF 74
            ||| ||.:   ..||...:...||.|...|...|..||.|.|||.||..||:::.|    ||..|
 Worm    30 PSS-STHI---QQPLALSDSFTLRRLQTWDRMAVEALCNESFPIQYPDCWYDEVVSGGLLSTGLF 90

  Fly    75 ---ALAAVYNLAIIGLIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSAD 136
               .|||        ::|:|.|...:.|                     ::|:||||.|   :|.
 Worm    91 DGEQLAA--------MVVSETKFLYDCN---------------------LEDQGILPSS---NAH 123

  Fly   137 VGYILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKRRFTLHS 201
            |.||||:.|.:..||.|:.:.||:.||:.|:....:. :|:|||.|:||..|:.||:...|..|:
 Worm   124 VAYILSIAVDKKFRRLGLATRLLNNLMSSLSDHPPYP-RAVFLHVLSTNSAALSFYKMHGFEFHA 187

  Fly   202 FLPY---YYNIRGKGKDGFTYVNYINGGHPPWTLLDHIKHYASMV-RHTSSLCAWLA 254
            .|||   ||.|..:..||.|||.||||.:...|..|..:.:.:.: ....::|..|:
 Worm   188 SLPYFREYYRIGEQLADGCTYVKYINGTYTNVTFTDVCRTFGNTICMPLKAICKMLS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 44/138 (32%)
Acetyltransf_1 <136..198 CDD:278980 24/61 (39%)
F30F8.10NP_001382268.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159397
Domainoid 1 1.000 58 1.000 Domainoid score I7170
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32610
Inparanoid 1 1.050 106 1.000 Inparanoid score I3507
Isobase 1 0.950 - 0 Normalized mean entropy S4876
OMA 1 1.010 - - QHG58755
OrthoDB 1 1.010 - - D1619974at2759
OrthoFinder 1 1.000 - - FOG0005438
OrthoInspector 1 1.000 - - oto20396
orthoMCL 1 0.900 - - OOG6_104382
Panther 1 1.100 - - LDO PTHR14744
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2980
SonicParanoid 1 1.000 - - X5008
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.