DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and Atac2

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_609889.1 Gene:Atac2 / 35113 FlyBaseID:FBgn0032691 Length:774 Species:Drosophila melanogaster


Alignment Length:214 Identity:48/214 - (22%)
Similarity:74/214 - (34%) Gaps:66/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FTLYNKHSAPP-----SSESTRVDCEHVPLCSINDVQLRFLVPDDLTEVRQLCQE--WFPIDYP- 60
            |...::..|||     .....||:..|....:|:   ..|:.|..:..|..|.|.  |..||.. 
  Fly   598 FIFRSETMAPPWLKLMCELQHRVNGSHPTRSTID---FCFVRPQHIPAVNALLQSTFWPNIDVSE 659

  Fly    61 -LSWYEDITSSTRFFALAAVYNLAIIGLIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDK 124
             || |.|       :::.|:|...:||                              .||.:.|.
  Fly   660 CLS-YPD-------YSVVALYKKLVIG------------------------------CGFLVPDV 686

  Fly   125 GILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQPAI 189
            |.         :..||..:.|....:|:||.|.:|..|:....:      |.|.||...|| .|:
  Fly   687 GY---------NEAYISFMAVRPCWQRSGIASFMLYHLIQTCMS------KDITLHVSATN-AAV 735

  Fly   190 FFYEKRRFTLHSFLPYYYN 208
            ..|:|..|.:...:..:|:
  Fly   736 MLYQKFGFKMEEIILDFYD 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 27/132 (20%)
Acetyltransf_1 <136..198 CDD:278980 18/61 (30%)
Atac2NP_609889.1 PHD 14..63 CDD:214584
rimI 639..753 CDD:273701 37/167 (22%)
Acetyltransf_1 676..744 CDD:278980 24/113 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.