DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and NAT8L

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_848652.2 Gene:NAT8L / 339983 HGNCID:26742 Length:302 Species:Homo sapiens


Alignment Length:155 Identity:34/155 - (21%)
Similarity:56/155 - (36%) Gaps:31/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 TRFFALAAVYNLAIIGLIVAEIKPYRNVNKEVI---------ANMSDSDELYTRLSG----FPMQ 122
            :|...|..:...|::||     :.|  .:::||         .:|:|.::.|.:..|    ..:.
Human   132 SRSLLLTCLVPAALLGL-----RYY--YSRKVIRAYLECALHTDMADIEQYYMKPPGSCFWVAVL 189

  Fly   123 D---KGILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTT 184
            |   .||:........:...:|.:.|....|..||...|...:   |..|..|:..|:.|.|...
Human   190 DGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKV---LEFAVVHNYSAVVLGTTAV 251

  Fly   185 NQPAIFFYEKRRF-----TLHSFLP 204
            ...|...||...|     :.|..||
Human   252 KVAAHKLYESLGFRHMGASDHYVLP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 33/152 (22%)
Acetyltransf_1 <136..198 CDD:278980 16/66 (24%)
NAT8LNP_848652.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..72
Acetyltransf_1 157..264 CDD:366181 23/109 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.